AV36913

Anti-ASCL2 (AB2) antibody produced in rabbit

IgG fraction of antiserum

• Código UNSPSC: 12352203
• NACRES: NA.41

Propiedades

• origen biológico: rabbit
• Nivel de calidad: 100
• conjugado: unconjugated
• forma del anticuerpo: IgG fraction of antiserum
• tipo de anticuerpo: primary antibodies
• clon: polyclonal
• formulario: buffered aqueous solution
• mol peso: 29 kDa
• reactividad de especies: mouse, human, rat
• concentración: 0.5 mg - 1 mg/mL
• técnicas: western blot: suitable
• Nº de acceso NCBI: NP_032580
• Nº de acceso UniProt: O35885
• Condiciones de envío: wet ice
• temp. de almacenamiento: −20°C
• Información sobre el gen: mouse ... ASCL2(17173)

Descripción

Descripción general

Achaete-scute complex homolog 2 (Drosophila), ASCL2, is a bHLH transcription factor. In mice it is expressed during the development of extraembroynic trophoblast lineages but repressed in other tissues and is essential for proper placental development.

Inmunógeno

Synthetic peptide directed towards the middle region of human ASCL2

Acciones bioquímicas o fisiológicas

Mouse ASCL2 is a member of the basic helix-loop-helix (BHLH) family of transcription factors. It is the first transcription factor shown to play a critical part in the development of the mammalian trophoblast lineage.

Secuencia

Synthetic peptide located within the following region: AAVARRNERERNRVKLVNLGFQALRQHVPHGGANKKLSKVETLRSAVEYI

Forma física

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Cláusula de descargo de responsabilidad

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Información de seguridad

• Código de clase de almacenamiento: 10 - Combustible liquids
• Clase de riesgo para el agua (WGK): WGK 1
• Punto de inflamabilidad (°F): Not applicable
• Punto de inflamabilidad (°C): Not applicable