Saltar al contenido
Merck
Todas las fotos(4)

Documentos clave

AV36567

Sigma-Aldrich

Anti-NUCB2 (AB2) antibody produced in rabbit

IgG fraction of antiserum

Sinónimos:

Anti-Nucleobindin 2

Iniciar sesiónpara Ver la Fijación de precios por contrato y de la organización
Todas las fotos(4)

About This Item

Código UNSPSC:
12352203
NACRES:
NA.41

origen biológico

rabbit

Nivel de calidad

100

conjugado

unconjugated

forma del anticuerpo

IgG fraction of antiserum

tipo de anticuerpo

primary antibodies

clon

polyclonal

formulario

buffered aqueous solution

mol peso

46 kDa

reactividad de especies

pig, human, dog, horse

concentración

0.5 mg - 1 mg/mL

técnicas

immunohistochemistry: suitable
western blot: suitable

Nº de acceso NCBI

NP_005004

Nº de acceso UniProt

P80303

Condiciones de envío

wet ice

temp. de almacenamiento

−20°C

modificación del objetivo postraduccional

unmodified

Información sobre el gen

human ... NUCB2(4925)

Inmunógeno

Synthetic peptide directed towards the middle region of human NUCB2

Acciones bioquímicas o fisiológicas

NUCB2 is an oncoprotein that is overexpressed in breast cancer. This protein binds calcium and is involved in energy homeostasis and eating regulation in the hypothalamus. It is an important prognostic marker in prostate cancer, promotes osteogenesis and has been identified as anorexigenic and anti-hyperglycemic protein.

Secuencia

Synthetic peptide located within the following region: MMKEHERREYLKTLNEEKRKEEESKFEEMKKKHENHPKVNHPGSKDQLKE

Forma física

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Cláusula de descargo de responsabilidad

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

¿No encuentra el producto adecuado?  

Pruebe nuestro Herramienta de selección de productos.

Código de clase de almacenamiento

10 - Combustible liquids

Clase de riesgo para el agua (WGK)

WGK 1

Punto de inflamabilidad (°F)

Not applicable

Punto de inflamabilidad (°C)

Not applicable

Certificados de análisis (COA)

Busque Certificados de análisis (COA) introduciendo el número de lote del producto. Los números de lote se encuentran en la etiqueta del producto después de las palabras «Lot» o «Batch»

¿Ya tiene este producto?

Encuentre la documentación para los productos que ha comprado recientemente en la Biblioteca de documentos.

Visite la Librería de documentos

Ruishu Li et al.
PloS one, 8(4), e61619-e61619 (2013-04-25)
NUCB2¹⁻⁸³ has been recently reported as an anorexigenic and anti-hyperglycemic peptide. Here we report that NUCB2¹⁻⁸³ promotes osteogenesis. It was found after two months of once-a-day intravenous injection of NUCB2¹⁻⁸³, bone mineral density of femora and lumbar vertebrae were increased
Hongtuan Zhang et al.
Journal of experimental & clinical cancer research : CR, 32, 77-77 (2014-01-16)
Nucleobindin 2 (NUCB2) protein, a novel oncoprotein, is overexpressed in breast cancer. To date, there have been no published data regarding the role of NUCB2 protein expression in prostate cancer (PCa). Therefore, this study was performed to investigate the correlations
Hongtuan Zhang et al.
Journal of experimental & clinical cancer research : CR, 32(1), 56-56 (2013-08-21)
Nucleobindin 2 (NUCB2) abnormal expression has been reported in gastric cancer and breast cancer. However, the role of NUCB2 in prostate cancer (PCa) remains unclear. The aim of the present study was to investigate the NUCB2 expression in PCa tissues
Mitsuhiro Yoshimura et al.
American journal of physiology. Regulatory, integrative and comparative physiology, 307(2), R225-R236 (2014-05-16)
Nesfatin-1/NucB2, an anorexigenic molecule, is expressed mainly in the hypothalamus, particularly in the supraoptic nucleus (SON) and the paraventricular nucleus (PVN). Nesfatin-1/NucB2 is also expressed in the subfornical organ (SFO). Because the SON and PVN are involved in body fluid

Nuestro equipo de científicos tiene experiencia en todas las áreas de investigación: Ciencias de la vida, Ciencia de los materiales, Síntesis química, Cromatografía, Analítica y muchas otras.

Póngase en contacto con el Servicio técnico