AV35259

Anti-P2RX2 (AB1) antibody produced in rabbit

IgG fraction of antiserum

• Sinónimos: Anti-Purinergic receptor P2X, ligand-gated ion channel, 2
• Código UNSPSC: 12352203
• NACRES: NA.41
• conjugado: unconjugated
• application: IHC; WB
• clon: polyclonal
• reactividad de especies: human
• citations: 2
• técnicas: immunohistochemistry: suitable; western blot: suitable

Propiedades

• origen biológico: rabbit
• Nivel de calidad: 100
• conjugado: unconjugated
• forma del anticuerpo: IgG fraction of antiserum
• tipo de anticuerpo: primary antibodies
• clon: polyclonal
• Formulario: buffered aqueous solution
• mol peso: 42 kDa
• reactividad de especies: human
• concentración: 0.5 mg - 1 mg/mL
• técnicas: immunohistochemistry: suitable; western blot: suitable
• Nº de acceso NCBI: NP_733782
• Nº de acceso UniProt: Q9UBL9-5
• Condiciones de envío: wet ice
• temp. de almacenamiento: −20°C
• modificación del objetivo postraduccional: unmodified
• Información sobre el gen: human ... P2RX2(22953)

Descripción

Descripción general

P2RX2 (P2X2) is a purinoceptor that functions as an ATP-gated ion channel. The ectodomain movements of this receptor have been analyzed using disulphide locking. In propyl-methanethiosulfonate-attached P2X2 receptors; lipid intercalation can be facilitated between the transmembrane domains during channel opening.
Rabbit Anti-P2RX2 antibody recognizes human and bovine P2RX2.

Inmunógeno

Synthetic peptide directed towards the middle region of human P2RX2

Aplicación

Rabbit Anti-P2RX2 is suitable for western blot (0.6 μg/ml) and IHC (4-8 μg/ml) applications.

Acciones bioquímicas o fisiológicas

P2RX2 belongs to the family of purinoceptors for ATP. This receptor functions as a ligand-gated ion channel. Binding to ATP mediates synaptic transmission between neurons and from neurons to smooth muscle. Six transcript variants encoding six distinct isoforms have been identified for this gene.

Secuencia

Synthetic peptide located within the following region: LIKNSIHYPKFHFSKGNIADRTDGYLKRCTFHEASDLYCPIFKLGFIVEK

Forma física

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Cláusula de descargo de responsabilidad

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Información de seguridad

• Código de clase de almacenamiento: 10 - Combustible liquids
• Clase de riesgo para el agua (WGK): WGK 1
• Punto de inflamabilidad (°F): Not applicable
• Punto de inflamabilidad (°C): Not applicable