AV35236

Anti-CACNG4 antibody produced in rabbit

affinity isolated antibody

• Sinónimos: Anti-Calcium channel, voltage-dependent, γ subunit 4, Anti-MGC11138, Anti-MGC24983
• Código UNSPSC: 12352203
• NACRES: NA.41
• clon: polyclonal
• application: WB
• reactividad de especies: human, rat, bovine, guinea pig, mouse, horse, rabbit
• técnicas: western blot: suitable
• citations: 1

Propiedades

• origen biológico: rabbit
• Nivel de calidad: 100
• conjugado: unconjugated
• forma del anticuerpo: affinity isolated antibody
• tipo de anticuerpo: primary antibodies
• clon: polyclonal
• Formulario: buffered aqueous solution
• mol peso: 36 kDa
• reactividad de especies: human, rat, bovine, guinea pig, mouse, horse, rabbit
• concentración: 0.5 mg - 1 mg/mL
• técnicas: western blot: suitable
• Nº de acceso NCBI: NP_055220
• Nº de acceso UniProt: Q9UBN1
• Condiciones de envío: wet ice
• temp. de almacenamiento: −20°C
• modificación del objetivo postraduccional: unmodified
• Información sobre el gen: human ... CACNG4(27092)

Descripción

Descripción general

CACNG4 is a type I transmembrane AMPA receptor regulatory protein (TARP). Studies have reported that targeted disruption in CACNG4 gene exaggerates spike-wave seizures in stargazer mouse.
Rabbit Anti-CACNG4 antibody recognizes chicken, zebrafish, bovine, human, mouse, and rat CACNG4.

Inmunógeno

Synthetic peptide directed towards the N terminal region of human CACNG4

Aplicación

Rabbit Anti-CACNG4 antibody is suitable for western blot applications at a concentration of 1 μg/ml.

Acciones bioquímicas o fisiológicas

L-type calcium channels are composed of five subunits. CACNG4 represents one of these subunits, gamma, and is one of several gamma subunit proteins. It is an integral membrane protein that is thought to stabilize the calcium channel in an inactive (closed) state. This gene is a member of the neuronal calcium channel gamma subunit gene subfamily of the PMP-22/EMP/MP20 family.L-type calcium channels are composed of five subunits. The protein encoded by this gene represents one of these subunits, gamma, and is one of several gamma subunit proteins. It is an integral membrane protein that is thought to stabilize the calcium channel in an inactive (closed) state. This gene is a member of the neuronal calcium channel gamma subunit gene subfamily of the PMP-22/EMP/MP20 family and is located in a cluster with two similar gamma subunit-encoding genes.L-type calcium channels are composed of five subunits. The protein encoded by this gene represents one of these subunits, gamma, and is one of several gamma subunit proteins. It is an integral membrane protein that is thought to stabilize the calcium channel in an inactive (closed) state. This gene is a member of the neuronal calcium channel gamma subunit gene subfamily of the PMP-22/EMP/MP20 family and is located in a cluster with two similar gamma subunit-encoding genes.

Secuencia

Synthetic peptide located within the following region: GPPPRRARGDLTHSGLWRVCCIEGIYKGHCFRINHFPEDNDYDHDSSEYL

Forma física

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Cláusula de descargo de responsabilidad

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Información de seguridad

• Código de clase de almacenamiento: 10 - Combustible liquids
• Clase de riesgo para el agua (WGK): WGK 2
• Punto de inflamabilidad (°F): Not applicable
• Punto de inflamabilidad (°C): Not applicable