AV35090
Anti-KCNK3 antibody produced in rabbit
IgG fraction of antiserum
Sinónimos:
Anti-Potassium channel, subfamily K, member 3
Iniciar sesiónpara Ver la Fijación de precios por contrato y de la organización
About This Item
Código UNSPSC:
12352203
NACRES:
NA.41
origen biológico
rabbit
conjugado
unconjugated
forma del anticuerpo
IgG fraction of antiserum
tipo de anticuerpo
primary antibodies
clon
polyclonal
formulario
buffered aqueous solution
mol peso
43 kDa
reactividad de especies
dog, guinea pig, rat, sheep, human, bovine, mouse
concentración
0.5 mg - 1 mg/mL
técnicas
western blot: suitable
Nº de acceso NCBI
Nº de acceso UniProt
Condiciones de envío
wet ice
temp. de almacenamiento
−20°C
modificación del objetivo postraduccional
unmodified
Información sobre el gen
human ... KCNK3(3777)
Descripción general
KCNK3 (TASK1) is a potassium channel protein that contains pore-forming domains. ML365 is known to selectively inhibit KCNK3. It is involved in the chemosensory regulation of breathing. KCNK3 variations have been linked to BP and aldosterone production.
Rabbit Anti-KCNK3 antibody recognizes human, mouse, rat, bovine, canine, and rabbit KCNK3.
Rabbit Anti-KCNK3 antibody recognizes human, mouse, rat, bovine, canine, and rabbit KCNK3.
Inmunógeno
Synthetic peptide directed towards the C terminal region of human KCNK3
Aplicación
Rabbit Anti-KCNK3 antibody is suitable for western blot applications at a concentration of 1.25 μg/ml.
Acciones bioquímicas o fisiológicas
KCNK3 encodes one of the members of the superfamily of potassium channel proteins containing two pore-forming P domains. The gene product is an outwardly rectifying channel that is sensitive to changes in extracellular pH and is inhibited by extracellular acidification. Also referred to as an acid-sensitive potassium channel, it is activated by the anesthetics halothane and isoflurane. Although three transcripts are detected in northern blots, there is currently no sequence available to confirm transcript variants for this gene.
Secuencia
Synthetic peptide located within the following region: TCVEQSHSSPGGGGRYSDTPSRRCLCSGAPRSAISSVSTGLHSLSTFRGL
Forma física
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Cláusula de descargo de responsabilidad
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
¿No encuentra el producto adecuado?
Pruebe nuestro Herramienta de selección de productos.
Código de clase de almacenamiento
10 - Combustible liquids
Clase de riesgo para el agua (WGK)
WGK 3
Punto de inflamabilidad (°F)
Not applicable
Punto de inflamabilidad (°C)
Not applicable
Certificados de análisis (COA)
Busque Certificados de análisis (COA) introduciendo el número de lote del producto. Los números de lote se encuentran en la etiqueta del producto después de las palabras «Lot» o «Batch»
¿Ya tiene este producto?
Encuentre la documentación para los productos que ha comprado recientemente en la Biblioteca de documentos.
ML365: Development of Bis-Amides as Selective Inhibitors of the KCNK3/TASK1 Two Pore Potassium Channel.
Zou B, et al.
SourceProbe Reports from the NIH Molecular Libraries Program [Internet]. (2013)
Jeesun Jung et al.
The Journal of clinical endocrinology and metabolism, 97(11), E2160-E2167 (2012-08-16)
Two potassium (K) channel genes, Kcnk3 and Kcnk9, when deleted in mice, produced a model of hyperaldosteronism and hypertension. Our objective was to explore genetic variation [single-nucleotide polymorphisms (SNP)] in KCNK3 and KCNK9 in relation to blood pressure (BP) and
Stefan Trapp et al.
The Journal of neuroscience : the official journal of the Society for Neuroscience, 28(35), 8844-8850 (2008-08-30)
Acid-sensitive K+ channels of the tandem P-domain K+-channel family (TASK-1 and TASK-3) have been implicated in peripheral and central respiratory chemosensitivity; however, because of the lack of decisive pharmacological agents, the final proof of the role of the TASK channel
Constanze Schmidt et al.
Circulation, 132(2), 82-92 (2015-05-09)
Antiarrhythmic management of atrial fibrillation (AF) remains a major clinical challenge. Mechanism-based approaches to AF therapy are sought to increase effectiveness and to provide individualized patient care. K(2P)3.1 (TASK-1 [tandem of P domains in a weak inward-rectifying K+ channel-related acid-sensitive
Nuestro equipo de científicos tiene experiencia en todas las áreas de investigación: Ciencias de la vida, Ciencia de los materiales, Síntesis química, Cromatografía, Analítica y muchas otras.
Póngase en contacto con el Servicio técnico