Saltar al contenido
Merck
Todas las fotos(2)

Key Documents

AV34704

Sigma-Aldrich

Anti-ZMyND11 (AB1) antibody produced in rabbit

IgG fraction of antiserum

Sinónimos:

Anti-BRAM1, Anti-BS69, Anti-MGC111056, Anti-RP11-486H9.1, Anti-Zinc finger, MyND domain containing 11

Iniciar sesiónpara Ver la Fijación de precios por contrato y de la organización
Todas las fotos(2)

About This Item

Código UNSPSC:
12352203
NACRES:
NA.41

origen biológico

rabbit

Nivel de calidad

100

conjugado

unconjugated

forma del anticuerpo

IgG fraction of antiserum

tipo de anticuerpo

primary antibodies

clon

polyclonal

formulario

buffered aqueous solution

mol peso

42 kDa

reactividad de especies

human, rat, horse, guinea pig, bovine, dog, rabbit, mouse

concentración

0.5 mg - 1 mg/mL

técnicas

immunohistochemistry: suitable
western blot: suitable

Nº de acceso NCBI

NP_997644

Nº de acceso UniProt

Q6PJR5

Condiciones de envío

wet ice

temp. de almacenamiento

−20°C

modificación del objetivo postraduccional

unmodified

Información sobre el gen

human ... ZMYND11(10771)

Descripción general

ZMyND11 is a zinc-finger protein that links H3, 3K36me3 to tumor suppression and transcriptional elongation. ZMyND11 has also been implicated in poorly differentiated myeloid leukemia.
Rabbit Anti-ZMyND11 antibody recognizes bovine, chicken, human, mouse, rat, and canine ZMyND11.

Inmunógeno

Synthetic peptide directed towards the middle region of human ZMYND11

Aplicación

Rabbit Anti-ZMyND11 (AB1) antibody is suitable for western blot (2.5 μg/ml) and IHC (4-8 μg/ml) assays.

Acciones bioquímicas o fisiológicas

ZMYND11 was first identified by its ability to bind the adenovirus E1A protein. The protein localizes to the nucleus. It functions as a transcriptional repressor, and expression of E1A inhibits this repression.

Secuencia

Synthetic peptide located within the following region: SMGWKKACDELELHQRFLREGRFWKSKNEDRGEEEAESSISSTSNEQLKV

Forma física

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Cláusula de descargo de responsabilidad

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

¿No encuentra el producto adecuado?  

Pruebe nuestro Herramienta de selección de productos.

Código de clase de almacenamiento

10 - Combustible liquids

Clase de riesgo para el agua (WGK)

WGK 3

Punto de inflamabilidad (°F)

Not applicable

Punto de inflamabilidad (°C)

Not applicable

Certificados de análisis (COA)

Busque Certificados de análisis (COA) introduciendo el número de lote del producto. Los números de lote se encuentran en la etiqueta del producto después de las palabras «Lot» o «Batch»

¿Ya tiene este producto?

Encuentre la documentación para los productos que ha comprado recientemente en la Biblioteca de documentos.

Visite la Librería de documentos

Recurrent translocation (10;17)(p15;q21) in acute poorly differentiated myeloid leukemia likely results in ZMYND11-MBTD1 fusion.
Etienne De Braekeleer et al.
Leukemia & lymphoma, 55(5), 1189-1190 (2013-08-07)
Santanu Adhikary et al.
The Journal of biological chemistry, 291(6), 2664-2681 (2015-12-15)
ZMYND8 (zinc finger MYND (Myeloid, Nervy and DEAF-1)-type containing 8), a newly identified component of the transcriptional coregulator network, was found to interact with the Nucleosome Remodeling and Deacetylase (NuRD) complex. Previous reports have shown that ZMYND8 is instrumental in
Hong Wen et al.
Nature, 508(7495), 263-268 (2014-03-05)
Recognition of modified histones by 'reader' proteins plays a critical role in the regulation of chromatin. H3K36 trimethylation (H3K36me3) is deposited onto the nucleosomes in the transcribed regions after RNA polymerase II elongation. In yeast, this mark in turn recruits

Nuestro equipo de científicos tiene experiencia en todas las áreas de investigación: Ciencias de la vida, Ciencia de los materiales, Síntesis química, Cromatografía, Analítica y muchas otras.

Póngase en contacto con el Servicio técnico