AV34484

Anti-SMARCA2 antibody produced in rabbit

affinity isolated antibody

• Número MDL: MFCD05665220
• Código UNSPSC: 12352203
• NACRES: NA.41

Propiedades

• origen biológico: rabbit
• Nivel de calidad: 100
• conjugado: unconjugated
• forma del anticuerpo: affinity isolated antibody
• tipo de anticuerpo: primary antibodies
• clon: polyclonal
• Formulario: buffered aqueous solution
• mol peso: 32 kDa
• reactividad de especies: mouse, rabbit, horse, bovine, human, dog, guinea pig, rat
• concentración: 0.5 mg - 1 mg/mL
• técnicas: immunohistochemistry: suitable; western blot: suitable
• Nº de acceso NCBI: NP_620614
• Nº de acceso UniProt: P51531
• Condiciones de envío: wet ice
• temp. de almacenamiento: −20°C
• modificación del objetivo postraduccional: unmodified
• Información sobre el gen: human ... SMARCA2(6595)

Descripción

Descripción general

SWItch/Sucrose Non-Fermentable (SWI/SNF)-related matrix-associated actin-dependent regulator of chromatin subfamily A member 2 (SMARCA2) is a member of the SWI/SNF family of proteins and is highly like the Brahma protein of Drosophila. Two transcript variants encoding different isoforms have been found for this gene, which contains a trinucleotide repeat (CAG) length polymorphism.

Inmunógeno

Synthetic peptide directed towards the middle region of human SMARCA2

Aplicación

Rabbit Anti-SMARCA2 can be used for western blot applications at a concentration of 0.5 μg/ml. It can also be used for IHC applications at 4-8 μg/ml.

Acciones bioquímicas o fisiológicas

SMARCA2 protein is a part of the large adenosine triphosphate (ATP)-dependent chromatin remodeling complex SWItch/sucrose non-fermentable (SWI/SNF), which is required for transcriptional activation of genes normally repressed by chromatin. Members of SWI/SNF family have helicase and ATPase activities and are thought to regulate transcription of certain genes by altering the chromatin structure around those genes.

Secuencia

Synthetic peptide located within the following region: VINYKDSSGRQLSEVFIQLPSRKELPEYYELIRKPVDFKKIKERIRNHKY

Forma física

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Cláusula de descargo de responsabilidad

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Información de seguridad

• Código de clase de almacenamiento: 10 - Combustible liquids
• Clase de riesgo para el agua (WGK): WGK 3
• Punto de inflamabilidad (°F): Not applicable
• Punto de inflamabilidad (°C): Not applicable