AV33859

Anti-CPA1 antibody produced in rabbit

affinity isolated antibody

• Sinónimos: Anti-Carboxypeptidase A1 (pancreatic)
• Código UNSPSC: 12352203
• NACRES: NA.41

Propiedades

• origen biológico: rabbit
• Nivel de calidad: 100
• conjugado: unconjugated
• forma del anticuerpo: affinity isolated antibody
• tipo de anticuerpo: primary antibodies
• clon: polyclonal
• formulario: buffered aqueous solution
• mol peso: 47 kDa
• reactividad de especies: horse, human
• concentración: 0.5 mg - 1 mg/mL
• técnicas: western blot: suitable
• Nº de acceso NCBI: NP_001859
• Nº de acceso UniProt: P15085
• Condiciones de envío: wet ice
• temp. de almacenamiento: −20°C
• Información sobre el gen: human ... CPA1(1357)

Descripción

Inmunógeno

Synthetic peptide directed towards the N terminal region of human CPA1

Aplicación

Anti-CPA1 antibody produced in rabbit is suitable for western blot analysis.

Acciones bioquímicas o fisiológicas

CPA1 (Carboxypeptidase A1) is a zinc metalloenzyme belonging to the tetragonal space group P4(3)2(1)2. It forms a multiprotein complex, Zn²⁺-poly(acrylic acid), by directly interacting with proteases in the gastrointestinal tract. It stimulates the hydrolytic separation of carboxyl-terminal aromatic or branched aliphatic side chain of amide bonds from peptides and proteins.

Secuencia

Synthetic peptide located within the following region: QVLRISVADEAQVQKVKELEDLEHLQLDFWRGPAHPGSPIDVRVPFPSIQ

Forma física

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Cláusula de descargo de responsabilidad

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Información de seguridad

• Código de clase de almacenamiento: 10 - Combustible liquids
• Clase de riesgo para el agua (WGK): WGK 3
• Punto de inflamabilidad (°F): Not applicable
• Punto de inflamabilidad (°C): Not applicable