AV33096

Anti-HSPA1A antibody produced in rabbit

IgG fraction of antiserum

• Sinónimos: Anti-Heat shock 70 kDa protein 1A
• Código UNSPSC: 12352203
• NACRES: NA.41

Propiedades

• origen biológico: rabbit
• Nivel de calidad: 100
• conjugado: unconjugated
• forma del anticuerpo: IgG fraction of antiserum
• tipo de anticuerpo: primary antibodies
• clon: polyclonal
• formulario: buffered aqueous solution
• mol peso: 52 kDa
• reactividad de especies: bovine, goat, guinea pig, dog, human, sheep, rat, horse, rabbit, mouse; bovine, goat, human, dog, guinea pig, sheep, rat, horse, mouse, rabbit
• concentración: 0.5 mg - 1 mg/mL
• técnicas: western blot: suitable
• Nº de acceso NCBI: NP_005337
• Nº de acceso UniProt: P08107
• Condiciones de envío: wet ice
• temp. de almacenamiento: −20°C
• modificación del objetivo postraduccional: unmodified
• Información sobre el gen: human ... HSPA1A(3303)

Descripción

Descripción general

Heat shock 70 kDa protein 1A (HSPA1A, eHSP70, HSP72) is an environmental stress-inducible extracellular/plasma circulating heat shock protein that interacts with effector cells of the innate immune system. HSPA1A promotes the proliferation of H22 hepatocarcinoma cells through TLR2 and TLR4 signaling. HSPAIA signaling via TLR4 may trigger O3-induced lung inflammation. HSPA1A and its in vivo antibodies may contribute to the development of atherosclerosis. HSPA1A may stimulate innate and adaptive proinflammatory immune responses.

Especificidad

Rabbit polyclonal anti- HSPA1A antibody reacts with zebrafish, human, mouse, rat, Caenorhabditis elegans, and canine plasma circulating 70 kDa heat shock proteins.

Inmunógeno

Synthetic peptide directed towards the middle region of human HSPA1A

Aplicación

Rabbit polyclonal anti- HSPA1A antibody is used to tag plasma circulating 70 kDa heat shock protein for detection and quantitation by immunocytochemical and immunohistochemical (IHC) techniques. It is used as a probe to determine the presence and roles of plasma circulating 70 kDa heat shock proteins in the activation of cells containing TLR2 and TLR4 receptors, the stimulation of proinflammatory immune responses and the development of atherosclerosis.

Acciones bioquímicas o fisiológicas

HSPA1A is a member of the heat shock protein 70 family. In conjuction with other heat shock proteins, this protein stabilizes existing proteins against aggregation and mediates the folding of newly translated proteins in the cytosol and in organelles. It is also involved in the ubiquitin-proteasome pathway through interaction with the AU-rich element RNA-binding protein 1.

Secuencia

Synthetic peptide located within the following region: SLFEGIDFYTSITRARFEELCSDLFRSTLEPVEKALRDAKLDKAQIHDLV

Forma física

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Cláusula de descargo de responsabilidad

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Información de seguridad

• Código de clase de almacenamiento: 10 - Combustible liquids
• Clase de riesgo para el agua (WGK): WGK 3
• Punto de inflamabilidad (°F): Not applicable
• Punto de inflamabilidad (°C): Not applicable