AV32872

Anti-ZBTB7C antibody produced in rabbit

IgG fraction of antiserum

• Sinónimos: Anti-Zinc finger and BTB domain containing 7C
• Código UNSPSC: 12352203
• NACRES: NA.41
• conjugado: unconjugated
• application: WB
• clon: polyclonal
• reactividad de especies: rat, horse, guinea pig, dog, rabbit, goat, human, mouse, bovine
• citations: 3
• técnicas: western blot: suitable

Propiedades

• origen biológico: rabbit
• Nivel de calidad: 100
• conjugado: unconjugated
• forma del anticuerpo: IgG fraction of antiserum
• tipo de anticuerpo: primary antibodies
• clon: polyclonal
• Formulario: buffered aqueous solution
• mol peso: 69 kDa
• reactividad de especies: rat, horse, guinea pig, dog, rabbit, goat, human, mouse, bovine
• concentración: 0.5 mg - 1 mg/mL
• técnicas: western blot: suitable
• Nº de acceso NCBI: NP_001034449
• Nº de acceso UniProt: O73453
• Condiciones de envío: wet ice
• temp. de almacenamiento: −20°C
• modificación del objetivo postraduccional: unmodified
• Información sobre el gen: human ... ZBTB7C(201501)

Descripción

Descripción general

ZBTB7C is a zinc-finger protein that functions as a tumor suppressor. Decreased ZBTB7C expression has been linked to cervical carcinoma.
Rabbit Anti-ZBTB7C antibody recognizes rat, mouse, bovine, human, chicken, and canine ZBTB7C.

Inmunógeno

Synthetic peptide directed towards the N terminal region of human ZBTB7C

Aplicación

Rabbit Anti-ZBTB7C antibody can be used for western blotting applications at a concentration of 5μg/ml.

Acciones bioquímicas o fisiológicas

The function of Anti-ZBTB7C has not yet been determined.

Secuencia

Synthetic peptide located within the following region: MANDIDELIGIPFPNHSSEVLCSLNEQRHDGLLCDVLLVVQEQEYRTHRS

Forma física

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Cláusula de descargo de responsabilidad

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Información de seguridad

• Código de clase de almacenamiento: 10 - Combustible liquids
• Clase de riesgo para el agua (WGK): WGK 3
• Punto de inflamabilidad (°F): Not applicable
• Punto de inflamabilidad (°C): Not applicable