AV32790

Anti-ACAT2 (AB1) antibody produced in rabbit

IgG fraction of antiserum

• Sinónimos: Anti-Acetyl-coenzyme A acetyltransferase 2 (acetoacetyl coenzyme A thiolase)
• Código UNSPSC: 12352203
• NACRES: NA.41

Propiedades

• origen biológico: rabbit
• Nivel de calidad: 100
• conjugado: unconjugated
• forma del anticuerpo: IgG fraction of antiserum
• tipo de anticuerpo: primary antibodies
• clon: polyclonal
• Formulario: buffered aqueous solution
• mol peso: 41 kDa
• reactividad de especies: human, bovine, guinea pig, rat
• concentración: 0.5 mg - 1 mg/mL
• técnicas: immunohistochemistry: suitable; western blot: suitable
• Nº de acceso NCBI: NP_005882
• Nº de acceso UniProt: Q9BWD1
• Condiciones de envío: wet ice
• temp. de almacenamiento: −20°C
• modificación del objetivo postraduccional: unmodified
• Información sobre el gen: human ... ACAT2(39)

Descripción

Descripción general

ACAT2 is an acyl-coenzyme A cholesterol acyltransferase that regulates the esterification of cholesterol in cells. ACAT2 has been recommended as a treatment target for hypercholesterolemia and atherosclerosis. It has also been implicated in the inhibition of apoB secretion in liver cells.
Rabbit Anti-ACAT2 (AB1) antibody recognizes bovine, human, mouse, and rat ACAT2.

Inmunógeno

Synthetic peptide directed towards the middle region of human ACAT2

Aplicación

Rabbit Anti-ACAT2 (AB1) antibody can be used for western blot applications at a concentration of 1 μg/ml. It can also be used for IHC applications at 4-8 μg/ml.

Acciones bioquímicas o fisiológicas

Acetyl-Coenzyme A acetyltransferase 2 is an enzyme involved in lipid metabolism. Reported patients with ACAT2 deficiency have shown severe mental retardation and hypotonus. The ACAT2 gene shows complementary overlapping with the 3-prime region of the TCP1 gene in both mouse and human. These genes are encoded on opposite strands of DNA, as well as in opposite transcriptional orientation.

Secuencia

Synthetic peptide located within the following region: SREDQDKVAVLSQNRTENAQKAGHFDKEIVPVLVSTRKGLIEVKTDEFPR

Forma física

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Cláusula de descargo de responsabilidad

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Información de seguridad

• Código de clase de almacenamiento: 10 - Combustible liquids
• Clase de riesgo para el agua (WGK): WGK 3
• Punto de inflamabilidad (°F): Not applicable
• Punto de inflamabilidad (°C): Not applicable