AV32788

Anti-ACADM antibody produced in rabbit

affinity isolated antibody

• Sinónimos: Anti-ACAD1, Anti-Acyl-coenzyme A dehydrogenase, C-4 to C-12 straight chain, Anti-MCAD, Anti-MCADH
• Código UNSPSC: 12352203
• NACRES: NA.41

Propiedades

• origen biológico: rabbit
• Nivel de calidad: 100
• conjugado: unconjugated
• forma del anticuerpo: affinity isolated antibody
• tipo de anticuerpo: primary antibodies
• clon: polyclonal
• formulario: buffered aqueous solution
• mol peso: 46 kDa
• reactividad de especies: human
• concentración: 0.5 mg - 1 mg/mL
• técnicas: western blot: suitable
• Nº de acceso NCBI: NP_000007
• Nº de acceso UniProt: P11310
• Condiciones de envío: wet ice
• temp. de almacenamiento: −20°C
• modificación del objetivo postraduccional: unmodified
• Información sobre el gen: human ... ACADM(34)

Descripción

Descripción general

ACADM is an acyl CoA dehydrogenase that catalyzes the first step in the β-oxidation of mitochondrial fatty acids. ACADM mutations have been linked to medium-chain acyl-CoA dehydrogenase deficiency (MCADD) in newborns.
Rabbit Anti-ACADM antibody recognizes bovine, human, mouse, and rat ACADM.

Inmunógeno

Synthetic peptide directed towards the N terminal region of human ACADM

Aplicación

Rabbit Anti-ACADM antibody can be used for western blot applications at a concentration of 1 μg/ml.

Acciones bioquímicas o fisiológicas

ACADM Is the medium-chain specific (C4 to C12 straight chain) acyl-Coenzyme A dehydrogenase. The homotetramer enzyme catalyzes the initial step of the mitochondrial fatty acid beta-oxidation pathway. Clinical phenotypes are associated with ACADM hereditary deficiency.This gene encodes the medium-chain specific (C4 to C12 straight chain) acyl-Coenzyme A dehydrogenase. The homotetramer enzyme catalyzes the initial step of the mitochondrial fatty acid beta-oxidation pathway. Defects in this gene cause medium-chain acyl-CoA dehydrogenase deficiency, a disease characterized by hepatic dysfunction, fasting hypoglycemia, and encephalopathy, which can result in infantile death. Alternatively spliced transcript variants encoding different isoforms have been found for this gene.

Secuencia

Synthetic peptide located within the following region: AAGFGRCCRVLRSISRFHWRSQHTKANRQREPGLGFSFEFTEQQKEFQAT

Forma física

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Cláusula de descargo de responsabilidad

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Información de seguridad

• Código de clase de almacenamiento: 10 - Combustible liquids
• Clase de riesgo para el agua (WGK): WGK 3
• Punto de inflamabilidad (°F): Not applicable
• Punto de inflamabilidad (°C): Not applicable