AV32331

Anti-EYA3 antibody produced in rabbit

affinity isolated antibody

• Sinónimos: Anti-Eyes absent homolog 3 (Drosophila)
• Código UNSPSC: 12352203
• NACRES: NA.41
• conjugado: unconjugated
• application: IHC; WB
• clon: polyclonal
• reactividad de especies: human
• citations: 2
• técnicas: immunohistochemistry: suitable; western blot: suitable

Propiedades

• origen biológico: rabbit
• Nivel de calidad: 100
• conjugado: unconjugated
• forma del anticuerpo: affinity isolated antibody
• tipo de anticuerpo: primary antibodies
• clon: polyclonal
• Formulario: buffered aqueous solution
• mol peso: 63 kDa
• reactividad de especies: human
• concentración: 0.5 mg - 1 mg/mL
• técnicas: immunohistochemistry: suitable; western blot: suitable
• Nº de acceso NCBI: NP_001981
• Nº de acceso UniProt: Q99504
• Condiciones de envío: wet ice
• temp. de almacenamiento: −20°C
• modificación del objetivo postraduccional: unmodified
• Información sobre el gen: human ... EYA3(2140)

Descripción

Descripción general

EYA3 interacts with Six1 and subsequently activates TSHβ expression in response to light changes in the photoperiodic system of mice. EYA3 expression has also been implicated in Ewing sarcoma.
Rabbit Anti-EYA3 antibody recognizes human, mouse, rat, and canine EYA3.

Inmunógeno

Synthetic peptide directed towards the middle region of human EYA3

Aplicación

Rabbit Anti-EYA3 antibody can be used for IHC (4-8μg/ml) and western blot (0.05-1.0μg/ml) applications.

Acciones bioquímicas o fisiológicas

Eyes absent homolog 3 (EYA3) is a member of the eyes absent (EYA) family of proteins. This protein may act as a transcriptional activator and have a role during development. A similar protein in mice can act as a transcriptional activator. Two transcript variants encoding distinct isoforms have been identified for this gene.

Secuencia

Synthetic peptide located within the following region: QSRKNMTSKNRGKRKADATSSQDSELERVFLWDLDETIIIFHSLLTGSYA

Forma física

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Cláusula de descargo de responsabilidad

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Información de seguridad

• Código de clase de almacenamiento: 10 - Combustible liquids
• Clase de riesgo para el agua (WGK): WGK 3
• Punto de inflamabilidad (°F): Not applicable
• Punto de inflamabilidad (°C): Not applicable