AV31839

Anti-PTF1A antibody produced in rabbit

IgG fraction of antiserum

• Sinónimos: Anti-Pancreas specific transcription factor, 1a
• Código UNSPSC: 12352203
• NACRES: NA.41

Propiedades

• origen biológico: rabbit
• Nivel de calidad: 100
• conjugado: unconjugated
• forma del anticuerpo: IgG fraction of antiserum
• tipo de anticuerpo: primary antibodies
• clon: polyclonal
• formulario: buffered aqueous solution
• mol peso: 35 kDa
• reactividad de especies: human
• concentración: 0.5 mg - 1 mg/mL
• técnicas: western blot: suitable
• Nº de acceso NCBI: NP_835455
• Nº de acceso UniProt: Q7RTS3
• Condiciones de envío: wet ice
• temp. de almacenamiento: −20°C
• modificación del objetivo postraduccional: unmodified
• Información sobre el gen: human ... PTF1A(256297)

Descripción

Descripción general

PTF1A is a part of the pancreas transcription factor 1 complex that regulates the expression of exocrine pancreas-specific genes. Ptf1a is required for GABAergic neuronal cell fates during spinal cord development. Furthermore, Ptf1a provides a link between the development of inhibitory and excitatory interneurons. Mutations in PTF1A have been associated with diabetes mellitus and cerebellar agenesis.
Rabbit Anti-PTF1A antibody recognizes canine, human, mouse, rat, and zebrafish PTF1A.

Inmunógeno

Synthetic peptide directed towards the N terminal region of human PTF1A

Aplicación

Rabbit Anti-PTF1A antibody can be used for western blot application at a concentration of 2.5μg/ml.

Acciones bioquímicas o fisiológicas

PTF1A is a pancreas specific transcription factor. Mammalian studies have implicated important roles for the basic helix-loop-helix transcription factor PTF1A-p48 in the development of both exocrine and endocrine pancreas.

Secuencia

Synthetic peptide located within the following region: MDAVLLEHFPGGLDAFPSSYFDEDDFFTDQSSRDPLEDGDELLADEQAEV

Forma física

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Cláusula de descargo de responsabilidad

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Información de seguridad

• Código de clase de almacenamiento: 10 - Combustible liquids
• Clase de riesgo para el agua (WGK): WGK 3
• Punto de inflamabilidad (°F): Not applicable
• Punto de inflamabilidad (°C): Not applicable