AV31200

Anti-ISGF3G antibody produced in rabbit

affinity isolated antibody

• Sinónimos: Anti-IRF-9, Anti-ISGF3, Anti-ISGF3G, Anti-p48
• Código UNSPSC: 12352203
• NACRES: NA.41
• clon: polyclonal
• application: IHC; WB
• reactividad de especies: rabbit, human, rat, bovine, mouse, guinea pig, dog, horse
• técnicas: immunohistochemistry: suitable; western blot: suitable
• citations: 2

Propiedades

• origen biológico: rabbit
• Nivel de calidad: 100
• conjugado: unconjugated
• forma del anticuerpo: affinity isolated antibody
• tipo de anticuerpo: primary antibodies
• clon: polyclonal
• Formulario: buffered aqueous solution
• mol peso: 44 kDa
• reactividad de especies: rabbit, human, rat, bovine, mouse, guinea pig, dog, horse
• concentración: 0.5 mg - 1 mg/mL
• técnicas: immunohistochemistry: suitable; western blot: suitable
• Nº de acceso NCBI: NP_006075
• Nº de acceso UniProt: Q00978
• Condiciones de envío: wet ice
• temp. de almacenamiento: −20°C
• Información sobre el gen: human ... ISGF3G(10379)

Descripción

Descripción general

Interferon regulatory factor 9 (ISGF3G, IRF-9, p48) is a DNA-binding component of the heterotrimeric transcription factor ISGF3 which is activated by interferon-α and β (type I IFNs). The other two components of ISGF3 are STAT1 and STAT2. ISGF3 gamma or complexes containing ISGF3 gamma are involved in IRF-1-independent pathways mediating IFN gene regulation. ISGF3 plays a primary role in the transmission of a signal from the cell surface to the nucleus via regulatory factors p84/91 and p113.

Rabbit polyclonal anti-ISGF3G antibody reacts with pig, bovine, human, mouse, rat, and zebrafish interferon regulatory factor 9/ISGF3 gamma proteins.

Inmunógeno

Synthetic peptide directed towards the N terminal region of human ISGF3G

Aplicación

Rabbit Anti-ISGF3G antibody can be used for western blotting applications at 2.5μg/ml.

Rabbit polyclonal anti-ISGF3G antibody is used to tag interferon regulatory factor 9/ISGF3 gamma for detection and quantitation by immunocytochemical and immunohistochemical (IHC) techniques. It is used as a probe to determine the presence and roles of interferon regulatory factor 9/ISGF3 gamma in the mediation of interferon-α and β (type I IFNs) signaling.

Acciones bioquímicas o fisiológicas

ISGF3G functions to recruit RNA polymerase II to the promoter of interferon-stimulated genes and requires histone deacetylases. Defects in ISGF3 can cause resistance to IFN-.(2a) treatment.

Secuencia

Synthetic peptide located within the following region: PWKHAGKQDFREDQDAAFFKAWAIFKGKYKEGDTGGPAVWKTRLRCALNK

Forma física

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Cláusula de descargo de responsabilidad

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Información de seguridad

• Código de clase de almacenamiento: 10 - Combustible liquids
• Clase de riesgo para el agua (WGK): WGK 3
• Punto de inflamabilidad (°F): Not applicable
• Punto de inflamabilidad (°C): Not applicable