Saltar al contenido
Merck
Todas las fotos(1)

Documentos clave

AV13101

Sigma-Aldrich

Anti-GABRG3 antibody produced in rabbit

IgG fraction of antiserum

Sinónimos:

Anti-γ-Aminobutyric acid (GABA) A receptor, γ 3

Iniciar sesiónpara Ver la Fijación de precios por contrato y de la organización
Todas las fotos(1)

About This Item

Código UNSPSC:
12352203
NACRES:
NA.41

origen biológico

rabbit

Nivel de calidad

100

conjugado

unconjugated

forma del anticuerpo

IgG fraction of antiserum

tipo de anticuerpo

primary antibodies

clon

polyclonal

Formulario

buffered aqueous solution

mol peso

54 kDa

reactividad de especies

human

concentración

0.5 mg - 1 mg/mL

técnicas

western blot: suitable

Nº de acceso NCBI

NP_150092

Nº de acceso UniProt

Q99928

Condiciones de envío

wet ice

temp. de almacenamiento

−20°C

Información sobre el gen

human ... GABRG3(2567)

Inmunógeno

Synthetic peptide directed towards the N terminal region of human GABRG3

Aplicación

Anti-GABRG3 (AB2) antibody produced in rabbit is suitable for western blotting at a concentration of 1 μg/ml.

Acciones bioquímicas o fisiológicas

GABRG3 is a subunit of GABAA receptor, the main inhibitory receptor in the brain. Polymorphisms of GABRG3 gene result in altered responsiveness to GABA and may be involved in alcohol dependence.

Secuencia

Synthetic peptide located within the following region: LHARSRKVEEDEYEDSSSNQKWVLAPKSQDTDVTLILNKLLREYDKKLRP

Forma física

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Cláusula de descargo de responsabilidad

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

¿No encuentra el producto adecuado?  

Pruebe nuestro Herramienta de selección de productos.

Código de clase de almacenamiento

10 - Combustible liquids

Clase de riesgo para el agua (WGK)

WGK 3

Punto de inflamabilidad (°F)

Not applicable

Punto de inflamabilidad (°C)

Not applicable

Elija entre una de las versiones más recientes:

Certificados de análisis (COA)

Lot/Batch Number
QC0531

¿No ve la versión correcta?

Si necesita una versión concreta, puede buscar un certificado específico por el número de lote.

Busque por un COA

¿Ya tiene este producto?

Encuentre la documentación para los productos que ha comprado recientemente en la Biblioteca de documentos.

Visite la Librería de documentos

Danielle M Dick et al.
Alcoholism, clinical and experimental research, 28(1), 4-9 (2004-01-28)
Evidence from human, animal, and in vitro cell models suggests that gamma-aminobutyric acid (GABA), the major inhibitory neurotransmitter in the human central nervous system, is involved in many of the neurochemical pathways that affect alcohol use, abuse, and dependence. Both
H Hörtnagl et al.
Neuroscience, 236, 345-372 (2013-01-23)
The GABAA receptor is the main inhibitory receptor in the brain and its subunits originate from different genes or gene families (α1-α6, β1-β3, γ1-γ3, δ, ε, θ, π, or ρ1-3). In the mouse brain the anatomical distribution of GABAA receptor

Nuestro equipo de científicos tiene experiencia en todas las áreas de investigación: Ciencias de la vida, Ciencia de los materiales, Síntesis química, Cromatografía, Analítica y muchas otras.

Póngase en contacto con el Servicio técnico