Saltar al contenido
Merck
Todas las fotos(1)

Key Documents

AV01026

Sigma-Aldrich

Anti-CREB1 (AB2) antibody produced in rabbit

affinity isolated antibody

Sinónimos:

Anti-CREB, Anti-MGC9284, Anti-cAMP responsive element binding protein 1

Iniciar sesiónpara Ver la Fijación de precios por contrato y de la organización
Todas las fotos(1)

About This Item

Código UNSPSC:
12352203
NACRES:
NA.41

origen biológico

rabbit

Nivel de calidad

100

conjugado

unconjugated

forma del anticuerpo

affinity isolated antibody

tipo de anticuerpo

primary antibodies

clon

polyclonal

formulario

buffered aqueous solution

mol peso

37 kDa

reactividad de especies

pig, mouse, rat, bovine, canine, horse, zebrafish, human

concentración

0.5 mg - 1 mg/mL

técnicas

western blot: suitable

Nº de acceso NCBI

NP_604391

Nº de acceso UniProt

P16220

Condiciones de envío

wet ice

temp. de almacenamiento

−20°C

modificación del objetivo postraduccional

unmodified

Información sobre el gen

human ... CREB1(1385)

Categorías relacionadas

Descripción general

CREB1 is a leucine zipper transcription factor that interacts with cAMP-responsive element. Rabbit Anti-CREB1 (AB2) antibody recognizes zebrafish, human, mouse, rat, canine, pig, chicken, and bovine CREB1.

Inmunógeno

Synthetic peptide directed towards the N terminal region of human CREB1

Aplicación

Rabbit Anti-CREB1 (AB2) antibody can be used for western blot assays at 1μg/ml.

Secuencia

Synthetic peptide located within the following region: DSQESVDSVTDSQKRREILSRRPSYRKILNDLSSDAPGVPRIEEEKSEEE

Forma física

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Cláusula de descargo de responsabilidad

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

¿No encuentra el producto adecuado?  

Pruebe nuestro Herramienta de selección de productos.

Código de clase de almacenamiento

10 - Combustible liquids

Clase de riesgo para el agua (WGK)

WGK 3

Punto de inflamabilidad (°F)

Not applicable

Punto de inflamabilidad (°C)

Not applicable

Certificados de análisis (COA)

Busque Certificados de análisis (COA) introduciendo el número de lote del producto. Los números de lote se encuentran en la etiqueta del producto después de las palabras «Lot» o «Batch»

¿Ya tiene este producto?

Encuentre la documentación para los productos que ha comprado recientemente en la Biblioteca de documentos.

Visite la Librería de documentos

Zhenglin Zhao et al.
Neuroscience letters, 567, 19-23 (2014-03-29)
The role of neuropeptide Y (NPY) in the central nucleus of amygdala (CeA) in the preventive effects of acupuncture against ethanol withdrawal-induced anxiety was investigated. Rats were treated with 3g/kg/day of ethanol for 28 days, followed by 3 days of
Shuichi Moriya et al.
Journal of cellular biochemistry, 116(1), 142-148 (2014-08-29)
As the aged population is soaring, prevalence of osteoporosis is increasing. However, the molecular basis underlying the regulation of bone mass is still incompletely understood. Sympathetic tone acts via beta2 adrenergic receptors in bone and regulates the mass of bone
Catherine M Westbom et al.
The American journal of pathology, 184(10), 2816-2827 (2014-08-12)
Malignant mesothelioma (MM) is an aggressive tumor with no treatment regimen. Previously we have demonstrated that cyclic AMP response element binding protein (CREB) is constitutively activated in MM tumor cells and tissues and plays an important role in MM pathogenesis.
Sun-Young Lee et al.
International journal of oncology, 45(2), 675-682 (2014-05-29)
Nutlin-3 which occupies the p53 binding pocket in HDM2, has been reported to activate apoptosis through both the transcriptional activity-dependent and -independent programs of p53. Transcription-independent apoptosis by nutlin-3 is triggered by p53 which is translocated to mitochondria. However, we
Yoelvis García-Mesa et al.
Psychoneuroendocrinology, 45, 154-166 (2014-05-23)
Postmenopausal women may be more vulnerable to cognitive loss and Alzheimer's disease (AD) than premenopausal women because of their deficiency in estrogens, in addition to their usually older age. Aerobic physical exercise has been proposed as a therapeutic approach for
Ver todos los artículos relacionados

Nuestro equipo de científicos tiene experiencia en todas las áreas de investigación: Ciencias de la vida, Ciencia de los materiales, Síntesis química, Cromatografía, Analítica y muchas otras.

Póngase en contacto con el Servicio técnico