APREST94161

PrEST Antigen TRHR

Prestige Antigens Powered by Atlas Antibodies

• Código UNSPSC: 12352203

Propiedades

• recombinante: expressed in E. coli
• Análisis: >80% (SDS-PAGE)
• formulario: buffered aqueous solution
• mol peso: predicted mol wt 23 kDa
• purificado por: immobilized metal affinity chromatography (IMAC)
• concentración: ≥0.5 mg/mL
• secuencia del inmunógeno: ILFLNPIPSDPKENSKTWKNDSTHQNTNLNVNTSNRCFNSTVSSRKQVTK
• Ensembl | nº de acceso humano: ENSG00000174417
• Nº de acceso UniProt: P34981
• Condiciones de envío: wet ice
• temp. de almacenamiento: −20°C
• Información sobre el gen: human ... TRHR(7201)

Descripción

Descripción general

Recombinant protein fragment of Human TRHR with N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G) fusion tag

Aplicación

Blocking agent and positive assay control using corresponding antibodies.

Forma física

Solution in phosphate-buffered saline and 1M Urea, pH 7.4

Nota de preparación

Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.

Cláusula de descargo de responsabilidad

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Información de seguridad

• Código de clase de almacenamiento: 10 - Combustible liquids
• Clase de riesgo para el agua (WGK): WGK 2
• Punto de inflamabilidad (°F): Not applicable
• Punto de inflamabilidad (°C): Not applicable