Saltar al contenido
Merck
Todas las fotos(5)

Documentos clave

AMAB90854

Sigma-Aldrich

Monoclonal Anti-RHOT1 antibody produced in mouse

Prestige Antibodies® Powered by Atlas Antibodies, clone CL1095, purified immunoglobulin, buffered aqueous glycerol solution

Sinónimos:

ARHT1, FLJ11040, MIRO-1

Iniciar sesiónpara Ver la Fijación de precios por contrato y de la organización


About This Item

Código UNSPSC:
12352203
NACRES:
NA.41

origen biológico

mouse

conjugado

unconjugated

forma del anticuerpo

purified immunoglobulin

tipo de anticuerpo

primary antibodies

clon

CL1095, monoclonal

Línea del producto

Prestige Antibodies® Powered by Atlas Antibodies

Formulario

buffered aqueous glycerol solution

reactividad de especies

human

técnicas

immunohistochemistry: 1:200- 1:500

isotipo

IgG1

Ensembl | nº de acceso humano

Nº de acceso UniProt

Condiciones de envío

wet ice

temp. de almacenamiento

−20°C

modificación del objetivo postraduccional

unmodified

Información sobre el gen

human ... RHOT1(55288)

Descripción general

Miro1/RHOT1 (ras homolog family member T1) is an outer mitochondrial membrane (OMM) protein. It has a transmembrane domain, two GTPase domains and two Ca2+-sensing EF-hand domains. RHOT1 is located on human chromosome 17q11.

Inmunógeno

ras homolog family member T1, recombinant protein epitope signature tag (PrEST)

Sequence
THIVDYSEAEQSDEQLHQEISQANVICIVYAVNNKHSIDKVTSRWIPLINERTDKDSRLPLILVGNKSDLVEYSSMETILPIMNQYTEIE

Epitope
Binds to an epitope located within the peptide sequence ERTDKDSRLP as determined by overlapping synthetic peptides.

Aplicación

Monoclonal Anti-RHOT1 antibody has been used in Immunoprecipitation.

Acciones bioquímicas o fisiológicas

Miro1/RHOT1 (ras homolog family member T1) regulates mitochondrial trafficking and distribution. The Rho GTPase Miro-1 plays a crucial role in the modulation of mitochondrial morphogenesis and acts as a calcium-dependent sensor for the control of mitochondrial motility.

Características y beneficios

Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.

Every Prestige Antibody is tested in the following ways:
  • IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
  • Protein array of 364 human recombinant protein fragments.

Ligadura / enlace

Corresponding Antigen APREST71907

Forma física

Phospate buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide

Información legal

Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany

Cláusula de descargo de responsabilidad

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

¿No encuentra el producto adecuado?  

Pruebe nuestro Herramienta de selección de productos.

Código de clase de almacenamiento

10 - Combustible liquids

Clase de riesgo para el agua (WGK)

WGK 1

Punto de inflamabilidad (°F)

Not applicable

Punto de inflamabilidad (°C)

Not applicable


Elija entre una de las versiones más recientes:

Certificados de análisis (COA)

Lot/Batch Number

¿No ve la versión correcta?

Si necesita una versión concreta, puede buscar un certificado específico por el número de lote.

¿Ya tiene este producto?

Encuentre la documentación para los productos que ha comprado recientemente en la Biblioteca de documentos.

Visite la Librería de documentos

K27 ubiquitination of the mitochondrial transport protein Miro is dependent on serine 65 of the Parkin ubiquitin ligase.
Birsa N, et al.
The Journal of Biological Chemistry, jbc-M114 (2014)
K27 ubiquitination of the mitochondrial transport protein Miro is dependent on serine 65 of the Parkin ubiquitin ligase.
Birsa N, et al.
Test, jbc-M114 (2014)
Miro-1 links mitochondria and microtubule Dynein motors to control lymphocyte migration and polarity
Morlino G, et al.
Molecular and Cellular Biology, MCB-01177 (2014)
Evidence-based genomic diagnosis characterized chromosomal and cryptic imbalances in 30 elderly patients with myelodysplastic syndrome and acute myeloid leukemia
Bajaj R, et al.
Molecular Cytogenetics, 4(1), 3-3 (2011)
Miro-1 links mitochondria and microtubule Dynein motors to control lymphocyte migration and polarity
Morlino G, et al.
Molecular and cellular biology, MCB-01177 (2014)

Nuestro equipo de científicos tiene experiencia en todas las áreas de investigación: Ciencias de la vida, Ciencia de los materiales, Síntesis química, Cromatografía, Analítica y muchas otras.

Póngase en contacto con el Servicio técnico