AMAB90854

Monoclonal Anti-RHOT1 antibody produced in mouse

Prestige Antibodies^® Powered by Atlas Antibodies, clone CL1095, purified immunoglobulin, buffered aqueous glycerol solution

• Sinónimos: ARHT1, FLJ11040, MIRO-1
• Código UNSPSC: 12352203
• NACRES: NA.41

Propiedades

• origen biológico: mouse
• conjugado: unconjugated
• forma del anticuerpo: purified immunoglobulin
• tipo de anticuerpo: primary antibodies
• clon: CL1095, monoclonal
• Línea del producto: Prestige Antibodies^® Powered by Atlas Antibodies
• formulario: buffered aqueous glycerol solution
• reactividad de especies: human
• técnicas: immunohistochemistry: 1:200- 1:500
• isotipo: IgG1
• Ensembl | nº de acceso humano: ENSG00000126858
• Nº de acceso UniProt: Q8IXI2
• Condiciones de envío: wet ice
• temp. de almacenamiento: −20°C
• modificación del objetivo postraduccional: unmodified
• Información sobre el gen: human ... RHOT1(55288)

Descripción

Descripción general

Miro1/RHOT1 (ras homolog family member T1) is an outer mitochondrial membrane (OMM) protein. It has a transmembrane domain, two GTPase domains and two Ca²⁺-sensing EF-hand domains. RHOT1 is located on human chromosome 17q11.

Inmunógeno

ras homolog family member T1, recombinant protein epitope signature tag (PrEST)

Sequence
THIVDYSEAEQSDEQLHQEISQANVICIVYAVNNKHSIDKVTSRWIPLINERTDKDSRLPLILVGNKSDLVEYSSMETILPIMNQYTEIE

Epitope
Binds to an epitope located within the peptide sequence ERTDKDSRLP as determined by overlapping synthetic peptides.

Aplicación

Monoclonal Anti-RHOT1 antibody has been used in Immunoprecipitation.

Acciones bioquímicas o fisiológicas

Miro1/RHOT1 (ras homolog family member T1) regulates mitochondrial trafficking and distribution. The Rho GTPase Miro-1 plays a crucial role in the modulation of mitochondrial morphogenesis and acts as a calcium-dependent sensor for the control of mitochondrial motility.

Características y beneficios

Prestige Antibodies^® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies^® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.

Every Prestige Antibody is tested in the following ways:

• IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
• Protein array of 364 human recombinant protein fragments.

Ligadura / enlace

Corresponding Antigen APREST71907

Forma física

Phospate buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide

Información legal

Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany

Cláusula de descargo de responsabilidad

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Información de seguridad

• Código de clase de almacenamiento: 10 - Combustible liquids
• Clase de riesgo para el agua (WGK): WGK 1
• Punto de inflamabilidad (°F): Not applicable
• Punto de inflamabilidad (°C): Not applicable