06-847

Anti-EGFR Antibody

Upstate^®, from rabbit

• Sinónimos: Receptor tyrosine-protein kinase ErbB-1, avian erythroblastic leukemia viral (v-erb-b) oncogene homolog, cell growth inhibiting protein 40, cell proliferation-inducing protein 61, epidermal growth factor receptor, epidermal growth factor receptor (avian
• Código UNSPSC: 12352203
• eCl@ss: 32160702
• NACRES: NA.41

Propiedades

• origen biológico: rabbit
• Nivel de calidad: 100
• forma del anticuerpo: purified immunoglobulin
• tipo de anticuerpo: primary antibodies
• clon: polyclonal
• reactividad de especies: rat, hamster, mouse, human
• envase: antibody small pack of 25 μg
• fabricante / nombre comercial: Upstate^®
• técnicas: immunoprecipitation (IP): suitable; western blot: suitable
• isotipo: IgG
• Nº de acceso NCBI: NP_005219
• Nº de acceso UniProt: P00533
• Condiciones de envío: ambient
• modificación del objetivo postraduccional: unmodified
• Información sobre el gen: hamster ... Egfr(100774580) ; human ... EGFR(1956) ; mouse ... Egfr(13649) ; rat ... Egf(25313)

Descripción

Descripción general

The epidermal growth factor receptor (EGFR; ErbB-1; HER1 in humans) is the cell-surface receptor for members of the epidermal growth factor family (EGF-family) of extracellular protein ligands. The epidermal growth factor receptor is a member of the ErbB family of receptors, a subfamily of four closely related receptor tyrosine kinases: EGFR (ErbB-1), HER2/c-neu (ErbB-2), Her 3 (ErbB-3) and Her 4 (ErbB-4). Mutations affecting EGFR expression or activity could result in cancer. EGFR (epidermal growth factor receptor) exists on the cell surface and is activated by binding of its specific ligands, including epidermal growth factor and transforming growth factor α (TGFα). Upon activation by its growth factor ligands, EGFR undergoes a transition from an inactive monomeric form to an active homodimer. In addition to forming homodimers after ligand binding, EGFR may pair with another member of the ErbB receptor family, such as ErbB2/Her2/neu, to create an activated heterodimer. EGFR dimerization stimulates its intrinsic intracellular protein-tyrosine kinase activity. As a result, autophosphorylation of five tyrosine (Y) residues in the C-terminal domain of EGFR occurs.

Especificidad

Recognizes the EGFR, Mr 180 kDa.

Reported to detect rat and hamster.

Inmunógeno

Ovalbumin conjugated synthetic peptide (ETKPNGIFKGPTAENAEYLRVAPPSSEFIGA) corresponding to amino acids 1156-1186 of the processed mouse EGF receptor (EGFR) C-terminal domain (Accession number Q01279). The immunizing sequence shares 28/31 identity with the human EGF receptor sequence.

Aplicación

Anti-EGFR Antibody detects level of EGFR & has been published & validated for use in IP & WB.

Immunoprecipitation:
4 µg of a previous lot immunoprecipitated the EGFR from 500 µg of a 3T3/A31 RIPA cell lysate.
Immunohistochemistry (Paraffin) Analysis: A 1:500 Dilution of this antibody detected EGFR in human placenta tissue sections.

Calidad

Routinely evaluated by western blot on a mouse 3T3/A31 RIPA cell lysate.

Western Blot Analysis:
0.5-2 µg/mL of this lot detected the EGFR from a mouse 3T3/A31 RIPA cell lysate.

Descripción de destino

180 kDa

Ligadura / enlace

Replaces: 04-337; 04-338

Forma física

Format: Purified

Purified rabbit polyclonal IgG in buffer containing 0.1M Tris-Glycine, 0.15M NaCl, 0.05% Sodium Azide, pH 7.4. Store at 2-8°C.

Almacenamiento y estabilidad

Stable for 1 year at 2-8°C from date of receipt.

Handling Recommendations: Upon first thaw,
and prior to removing the cap, centrifuge the
vial and gently mix the solution.

Nota de análisis

Control
Positive Antigen Control: Catalog #12-305, 3T3/A31 lysate. Add 2.5 μL of 2-mercapto-ethanol/100 μL of lysate and boil for 5 minutes to reduce the preparation. Load 20 μg of reduced lysate per lane for minigels.

Otras notas

Concentration: Please refer to the Certificate of Analysis for the lot-specific concentration.

Información legal

UPSTATE is a registered trademark of Merck KGaA, Darmstadt, Germany

Información de seguridad

• Código de clase de almacenamiento: 12 - Non Combustible Liquids
• Clase de riesgo para el agua (WGK): WGK 1
• Punto de inflamabilidad (°F): Not applicable
• Punto de inflamabilidad (°C): Not applicable