Skip to Content
Merck
All Photos(3)

Key Documents

AV42248

Sigma-Aldrich

Anti-SLC6A8 antibody produced in rabbit

IgG fraction of antiserum

Synonym(s):

Anti-CRTR, Anti-CT1, Anti-MGC87396, Anti-Solute carrier family 6 (neurotransmitter transporter, creatine), member 8

Sign Into View Organizational & Contract Pricing


About This Item

UNSPSC Code:
12352203
NACRES:
NA.41

biological source

rabbit

Quality Level

conjugate

unconjugated

antibody form

IgG fraction of antiserum

antibody product type

primary antibodies

clone

polyclonal

form

buffered aqueous solution

mol wt

70 kDa

species reactivity

human, mouse, bovine, horse, guinea pig, dog, rat

concentration

0.5 mg - 1 mg/mL

technique(s)

immunohistochemistry: suitable
western blot: suitable

NCBI accession no.

UniProt accession no.

shipped in

wet ice

storage temp.

−20°C

target post-translational modification

unmodified

Gene Information

human ... SLC6A8(6535)

General description

Solute carrier family 6 (neurotransmitter transporter, creatine), member 8/sodium- and chloride-dependent creatine transporter 1 (SLC6A8, CRTR, CT1) is required for the cellular uptake of creatine, which facilitates the storage of energy as ATP. Defects in SLC6A8/CRTR leads to creatine-deficiency syndrome evidenced by mental retardation and language delay.

Specificity

Anti-SLC6A8 polyclonal antibody reacts with bovine, canine, human, mouse, rat, pig, and rabbit sodium- and chloride-dependent creatine transporter 1 proteins

Immunogen

Synthetic peptide directed towards the N terminal region of human SLC6A8

Application

Anti-SLC6A8 polyclonal antibody is used to tag solute carrier family 6 (neurotransmitter transporter, creatine), member 8for detection and quantitation by Western blotting and in plasma by immunohistochemical (IHC) techniques. It is used as a probe to determine the roles of solute carrier family 6 (neurotransmitter transporter, creatine), member 8 in creatine homeostasis and the development of creatine-deficiency syndrome.

Biochem/physiol Actions

SLC6A8 is required for the uptake of creatine in muscles and brain.

Sequence

Synthetic peptide located within the following region: CDQLADRRSPVIEFWENKVLRLSGGLEVPGALNWEVTLCLLACWVLVYFC

Physical form

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Not finding the right product?  

Try our Product Selector Tool.

Storage Class Code

10 - Combustible liquids

WGK

WGK 3

Flash Point(F)

Not applicable

Flash Point(C)

Not applicable


Certificates of Analysis (COA)

Search for Certificates of Analysis (COA) by entering the products Lot/Batch Number. Lot and Batch Numbers can be found on a product’s label following the words ‘Lot’ or ‘Batch’.

Already Own This Product?

Find documentation for the products that you have recently purchased in the Document Library.

Visit the Document Library

Fernando Medina et al.
AIDS research and human retroviruses, 30(4), 370-379 (2013-12-11)
The human retrovirus human T cell lymphotropic virus type-I (HTLV-1) is the etiologic agent of HTLV-1-associated myelopathy/tropical spastic paraparesis (HAM/TSP). Axonal degeneration in HAM/TSP patients occurs without neuron infection, with the secreted viral Tax protein proposed to be involved. We
Hu Shan et al.
Molecular and cellular biochemistry, 397(1-2), 125-130 (2014-08-05)
Calreticulin (CRT) is a calcium-buffering protein which is predominantly located in endoplasmic reticulum. In the previous mitochondria proteome analysis, we accidentally found that CRT may be also localized at myocardial mitochondria and was upregulated in a rat model of furazolidone-induced

Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.

Contact Technical Service