WH0080301M3

Monoclonal Anti-pp9099 antibody produced in mouse

clone 3D9, purified immunoglobulin, buffered aqueous solution

• Synonym(s): Anti-DKFZp761K2312, Anti-PH domain-containing protein, Anti-PP1628
• UNSPSC Code: 12352203
• NACRES: NA.41

Properties

• biological source: mouse
• Quality Level: 100
• conjugate: unconjugated
• antibody form: purified immunoglobulin
• antibody product type: primary antibodies
• clone: 3D9, monoclonal
• form: buffered aqueous solution
• species reactivity: human
• technique(s): indirect ELISA: suitable; western blot: 1-5 μg/mL
• isotype: IgG1κ
• GenBank accession no.: NM_025201
• UniProt accession no.: Q8TD55
• shipped in: dry ice
• storage temp.: −20°C
• target post-translational modification: unmodified
• Gene Information: human ... PLEKHO2(80301)

Description

Immunogen

pp9099 (NP_079477, 392 a.a. ~ 490 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
GDLLGEGPRHPLQPRERLYRAQLEVKVASEQTEKLLNKVLGSEPAPVSAETLLSQAVEQLRQATQVLQEMRDLGELSQEAPGLREKRKELVTLYRRSAP

Physical form

Solution in phosphate buffered saline, pH 7.4

Legal Information

GenBank is a registered trademark of United States Department of Health and Human Services

Safety Information

• Storage Class Code: 10 - Combustible liquids
• WGK: nwg
• Flash Point(F): Not applicable
• Flash Point(C): Not applicable
• Personal Protective Equipment: dust mask type N95 (US), Eyeshields, Gloves