Skip to Content
Merck
All Photos(1)

Key Documents

SAB2105153

Sigma-Aldrich

Anti-TFF1 antibody produced in rabbit

affinity isolated antibody

Synonym(s):

Anti-BCEI, Anti-D21S21, Anti-HPS2, Anti-pNR-2, A

Sign Into View Organizational & Contract Pricing


About This Item

MDL number:
UNSPSC Code:
12352203
NACRES:
NA.41

biological source

rabbit

Quality Level

conjugate

unconjugated

antibody form

affinity isolated antibody

antibody product type

primary antibodies

clone

polyclonal

form

buffered aqueous solution

mol wt

7 kDa

species reactivity

human

concentration

0.5 mg - 1 mg/mL

technique(s)

western blot: suitable

NCBI accession no.

UniProt accession no.

shipped in

wet ice

storage temp.

−20°C

target post-translational modification

unmodified

Gene Information

human ... TFF1(7031)

General description

Members of the trefoil family are characterized by having at least one copy of the trefoil motif, a 40-amino acid domain that contains three conserved disulfides. They are stable secretory proteins expressed in gastrointestinal mucosa.
Trefoil factor 1 (TFF1) also known as breast cancer estrogen-inducible protein (BCEI) and pS2 protein, is highly expressed in the gastrointestinal mucosa. The protein was first characterized in the breast cancer cell line MCF-7. The gene TFF1 is localized on human chromosome 21q22.3.

Immunogen

Synthetic peptide directed towards the middle region of human TFF1

Biochem/physiol Actions

The major functions of TFF1 are mucosal repair incase of damage and maintenance of mucosal integrity. TFF1 promotes cell migration in breast cancer cells in response to estrogen. TFF1 is a tumour suppressor gene in gastric cancer and the mutation of which leads to development and progression of gastric cancer. TFF1 is an important marker in lobular endocervical glandular hyperplasia. TFF1 is a potent inhibitor of growth of calcium oxalate crystal growth in renal tubules.

Sequence

Synthetic peptide located within the following region: PRERQNCGFPGVTPSQCANKGCCFDDTVRGVPWCFYPNTIDVPPEEECEF

Physical form

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Not finding the right product?  

Try our Product Selector Tool.

Storage Class Code

10 - Combustible liquids

WGK

WGK 3

Flash Point(F)

Not applicable

Flash Point(C)

Not applicable


Choose from one of the most recent versions:

Certificates of Analysis (COA)

Lot/Batch Number

Don't see the Right Version?

If you require a particular version, you can look up a specific certificate by the Lot or Batch number.

Already Own This Product?

Find documentation for the products that you have recently purchased in the Document Library.

Visit the Document Library

Identification of human urinary trefoil factor 1 as a novel calcium oxalate crystal growth inhibitor
Chutipongtanate S, et al.
The Journal of Clinical Investigation, 115(12), 3613-3622 (2005)
The pS2/TFF1 trefoil factor, from basic research to clinical applications
Ribieras ST, et al.
Biochimica et Biophysica Acta - Reviews on Cancer, 1378(1), F61-F77 (1998)
Loss of heterozygosity and promoter methylation, but not mutation, may underlie loss of TFF1 in gastric carcinoma
Carvalho R, et al.
Laboratory Investigation; a Journal of Technical Methods and Pathology, 82(10), 1319-1326 (2002)
The three human trefoil genes TFF1, TFF2, and TFF3 are located within a region of 55 kb on chromosome 21q22. 3
Seib T, et al.
Genomics, 40(1), 200-202 (1997)
The estrogen-regulated protein, TFF1, stimulates migration of human breast cancer cells
Prest SJ, et al.
Faseb Journal, 16(6), 592-594 (2002)

Global Trade Item Number

SKUGTIN
SAB2105153-50UG
SAB2105153-100UL4061836120276

Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.

Contact Technical Service