SAB1411858

ANTI-FOXO1A antibody produced in mouse

clone 4A2, purified immunoglobulin, buffered aqueous solution

• Synonym(s): FKH1, FKHR, FOXO1A
• UNSPSC Code: 12352203
• NACRES: NA.41
• conjugate: unconjugated
• application: ELISA (i); IF
• clone: 4A2, monoclonal
• species reactivity: human
• technique(s): indirect ELISA: suitable; indirect immunofluorescence: suitable

Properties

• biological source: mouse
• Quality Level: 100
• conjugate: unconjugated
• antibody form: purified immunoglobulin
• antibody product type: primary antibodies
• clone: 4A2, monoclonal
• form: buffered aqueous solution
• mol wt: antigen 36.74 kDa
• species reactivity: human
• technique(s): indirect ELISA: suitable; indirect immunofluorescence: suitable
• isotype: IgG2aκ
• NCBI accession no.: NM_002015
• shipped in: dry ice
• storage temp.: −20°C
• target post-translational modification: unmodified
• Gene Information: human ... FOXO1A(2308)

Description

General description

This gene belongs to the forkhead family of transcription factors which are characterized by a distinct forkhead domain. The specific function of this gene has not yet been determined; however, it may play a role in myogenic growth and differentiation. Translocation of this gene with PAX3 has been associated with alveolar rhabdomyosarcoma. (provided by RefSeq)

Immunogen

FOXO1A (NP_002006, 556 a.a. ~ 655 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
TQVKTPVQVPLPHPMQMSALGGYSSVSSCNGYGRMGLLHQEKLPSDLDGMFIERLDCDMESIIRNDLMDGDTLDFNFDNVLPNQSFPHSVKTTTHSWVSG

Physical form

Solution in phosphate buffered saline, pH 7.4

Safety Information

• Storage Class Code: 10 - Combustible liquids
• Flash Point(F): Not applicable
• Flash Point(C): Not applicable