Skip to Content
Merck
All Photos(2)

Key Documents

WH0004591M1

Sigma-Aldrich

Monoclonal Anti-TRIM37 antibody produced in mouse

clone 2D11, purified immunoglobulin, buffered aqueous solution

Synonym(s):

Anti-KIAA0898, Anti-MUL, Anti-POB1, Anti-TEF3, Anti-tripartite motif-containing 37

Sign Into View Organizational & Contract Pricing


About This Item

UNSPSC Code:
12352203
NACRES:
NA.41

biological source

mouse

Quality Level

conjugate

unconjugated

antibody form

purified immunoglobulin

antibody product type

primary antibodies

clone

2D11, monoclonal

form

buffered aqueous solution

species reactivity

human

technique(s)

indirect ELISA: suitable
western blot: 1-5 μg/mL

isotype

IgG2aκ

GenBank accession no.

UniProt accession no.

shipped in

dry ice

storage temp.

−20°C

target post-translational modification

unmodified

Gene Information

human ... TRIM37(4591)

Related Categories

Immunogen

TRIM37 (NP_056109, 865 a.a. ~ 964 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
GHLEGLQMTDLENNSETGELQPVLPEGASAAPEEGMSSDSDIECDTENEEQEEHTSVGGFHDSFMVMTQPPDEDTHSSFPDGEQIGPEDLSFNTDENSGR

Biochem/physiol Actions

TRIM37 (Tripartite motif containing 37) restricts centriole reduplication during centriole biogenesis. It participates in epigenetic transcriptional repression by facilitating monoubiquitination of ′Lys-119′ of histone H2A (H2AK119Ub). TRIM37 also possesses anti-HIV activity. Mutation in TRIM37 causes an autosomal recessive prenatal-onset growth disorder, mulibrey nanism with dysmorphic features, cardiomyopathy, and hepatomegaly.

Physical form

Solution in phosphate buffered saline, pH 7.4

Legal Information

GenBank is a registered trademark of United States Department of Health and Human Services

Not finding the right product?  

Try our Product Selector Tool.

Storage Class Code

10 - Combustible liquids

Flash Point(F)

Not applicable

Flash Point(C)

Not applicable

Personal Protective Equipment

dust mask type N95 (US), Eyeshields, Gloves

Choose from one of the most recent versions:

Certificates of Analysis (COA)

Lot/Batch Number

Don't see the Right Version?

If you require a particular version, you can look up a specific certificate by the Lot or Batch number.

Already Own This Product?

Find documentation for the products that you have recently purchased in the Document Library.

Visit the Document Library

Fernando R Balestra et al.
Developmental cell, 25(6), 555-571 (2013-06-19)
Centrioles are essential for forming cilia, flagella, and centrosomes and are thus critical for a range of fundamental cellular processes. Despite their importance, the mechanisms governing centriole biogenesis remain incompletely understood. We performed a high-content genome-wide small-interfering-RNA-based screen to identify
Azah A Tabah et al.
The Journal of general virology, 95(Pt 4), 960-967 (2013-12-10)
Trim 5α was the first member of the tripartite motif (TRIM) family of proteins that was identified to potently restrict human immunodeficiency virus type 1 (HIV-1) replication. The breadth of antiretroviral activity of TRIM family members is an active area
Jukka Kallijärvi et al.
Experimental cell research, 308(1), 146-155 (2005-05-12)
Mulibrey nanism is an autosomal recessive prenatal-onset growth disorder characterized by dysmorphic features, cardiomyopathy, and hepatomegaly. Mutations in TRIM37 encoding a tripartite motif (TRIM, RING-B-box-coiled-coil)-family protein underlie mulibrey nanism. We investigated the ubiquitin ligase activity predicted for the RING domain

Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.

Contact Technical Service