WH0009402M1

Monoclonal Anti-GRAP2 antibody produced in mouse

clone 1G12, purified immunoglobulin, buffered aqueous solution

• Synonym(e): Anti-GADS, Anti-GRAP2, Anti-GRB2-related adaptor protein 2, Anti-GRB2L, Anti-GRBLG, Anti-GRID, Anti-GRPL, Anti-GrbX, Anti-Grf40, Anti-Mona, Anti-P38
• MDL-Nummer: MFCD03455450
• UNSPSC-Code: 12352203
• NACRES: NA.41

Eigenschaften

• Biologische Quelle: mouse
• Konjugat: unconjugated
• Antikörperform: purified immunoglobulin
• Antikörper-Produkttyp: primary antibodies
• Klon: 1G12, monoclonal
• Form: buffered aqueous solution
• Speziesreaktivität: human
• Methode(n): immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable; immunoprecipitation (IP): suitable; indirect ELISA: suitable; western blot: 1-5 μg/mL
• Isotyp: IgG2aκ
• GenBank-Hinterlegungsnummer: BC025692
• UniProt-Hinterlegungsnummer: O75791
• Versandbedingung: dry ice
• Lagertemp.: −20°C
• Posttranslationale Modifikation Target: unmodified
• Angaben zum Gen: human ... GRAP2(9402)

Beschreibung

Allgemeine Beschreibung

This gene encodes a member of the GRB2/Sem5/Drk family. This member is an adaptor-like protein involved in leukocyte-specific protein-tyrosine kinase signaling. Like its related family member, GRB2-related adaptor protein (GRAP), this protein contains an SH2 domain flanked by two SH3 domains. This protein interacts with other proteins, such as GRB2-associated binding protein 1 (GAB1) and the SLP-76 leukocyte protein (LCP2), through its SH3 domains. Transcript variants utilizing alternative polyA sites exist. (provided by RefSeq)

Immunogen

GRAP2 (AAH25692, 226 a.a. ~ 315 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
HHFHQERRGGSLDINDGHCGTGLGSEMNAALMHRRHTDPVQLQAAGRVRWARALYDFEALEDDELGFHSGEVVEVLDSSNPSWWTGRLHN

Leistungsmerkmale und Vorteile

Evaluate our antibodies with complete peace of mind. If the antibody does not perform in your application, we will issue a full credit or replacement antibody. Learn more.

Physikalische Form

Solution in phosphate buffered saline, pH 7.4

Rechtliche Hinweise

GenBank is a registered trademark of United States Department of Health and Human Services

Sicherheitshinweise

• Lagerklassenschlüssel: 10 - Combustible liquids
• Flammpunkt (°F): Not applicable
• Flammpunkt (°C): Not applicable
• Persönliche Schutzausrüstung: Eyeshields, Gloves, multi-purpose combination respirator cartridge (US)