WH0008772M1

Monoclonal Anti-FADD antibody produced in mouse

clone 3A12, purified immunoglobulin, buffered aqueous solution

• Synonym(e): Anti-Fas (TNFRSF6)-associated via death domain, Anti-GIG3, Anti-MGC8528, Anti-MORT1
• MDL-Nummer: MFCD01633337
• UNSPSC-Code: 12352203
• NACRES: NA.41

Eigenschaften

• Biologische Quelle: mouse
• Qualitätsniveau: 100
• Konjugat: unconjugated
• Antikörperform: purified immunoglobulin
• Antikörper-Produkttyp: primary antibodies
• Klon: 3A12, monoclonal
• Form: buffered aqueous solution
• Speziesreaktivität: human
• Methode(n): indirect ELISA: suitable; western blot: 1-5 μg/mL
• Isotyp: IgG1λ
• GenBank-Hinterlegungsnummer: BC000334
• UniProt-Hinterlegungsnummer: Q13158
• Versandbedingung: dry ice
• Lagertemp.: −20°C
• Posttranslationale Modifikation Target: unmodified
• Angaben zum Gen: human ... FADD(8772)

Beschreibung

Allgemeine Beschreibung

The protein encoded by this gene is an adaptor molecule that interacts with various cell surface receptors and mediates cell apoptotic signals. Through its C-terminal death domain, this protein can be recruited by TNFRSF6/Fas-receptor, tumor necrosis factor receptor, TNFRSF25, and TNFSF10/TRAIL-receptor, and thus it participates in the death signaling initiated by these receptors. Interaction of this protein with the receptors unmasks the N-terminal effector domain of this protein, which allows it to recruit caspase-8, and thereby activate the cysteine protease cascade. Knockout studies in mice also suggest the importance of this protein in early T cell development. (provided by RefSeq)

Immunogen

FADD (AAH00334, 109 a.a. ~ 208 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
GKDWRRLARQLKVSDTKIDSIEDRYPRNLTERVRESLRIWKNTEKENATVAHLVGALRSCQMNLVADLVQEVQQARDLQNRSGAMSPMSWNSDASTSEAS

Physikalische Form

Solution in phosphate buffered saline, pH 7.4

Rechtliche Hinweise

GenBank is a registered trademark of United States Department of Health and Human Services

Sicherheitshinweise

• Lagerklassenschlüssel: 10 - Combustible liquids
• Flammpunkt (°F): Not applicable
• Flammpunkt (°C): Not applicable
• Persönliche Schutzausrüstung: Eyeshields, Gloves, multi-purpose combination respirator cartridge (US)