WH0005325M1

Monoclonal Anti-PLAGL1 antibody produced in mouse

clone 1E2, ascites fluid

• Synonym(e): Anti-DKFZp781P1017, Anti-LOT1, Anti-ZAC, Anti-ZAC1, Anti-pleiomorphic adenoma gene-like 1
• UNSPSC-Code: 12352203
• NACRES: NA.43

Eigenschaften

• Biologische Quelle: mouse
• Konjugat: unconjugated
• Antikörperform: ascites fluid
• Antikörper-Produkttyp: primary antibodies
• Klon: 1E2, monoclonal
• Speziesreaktivität: human
• Methode(n): indirect ELISA: suitable; western blot: 1:500-1:1000
• Isotyp: IgMκ
• GenBank-Hinterlegungsnummer: NM_002656
• UniProt-Hinterlegungsnummer: Q9UM63
• Versandbedingung: dry ice
• Lagertemp.: −20°C
• Posttranslationale Modifikation Target: unmodified
• Angaben zum Gen: human ... PLAGL1(5325)

Beschreibung

Allgemeine Beschreibung

This gene encodes a C2H2 zinc finger protein with transactivation and DNA-binding activity. This gene has been shown to exhibit antiproliferative activities and is a tumor suppressor gene candidate. Many transcript variants encoding two different isoforms have been found for this gene. (provided by RefSeq)

Immunogen

PLAGL1 (NP_002647.2, 221 a.a. ~ 320 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
QPMQPLPESLASLHPSVSPGSPPPPLPNHKYNTTSTSYSPLASLPLKADTKGFCNISLFEDLPLQEPQSPQKLNPGFDLAKGNAGKVNLPKELPADAVNL

Biochem./physiol. Wirkung

The maternally-imprinted gene, PLAGL1 (pleiomorphic adenoma-like protein 1), functions as an oncogene as well as a tumor suppressor depending on the cell context. It has been found to exhibit anti-proliferative properties and regulate apoptosis and cell-cycle arrest via p53.

Physikalische Form

Solution

Rechtliche Hinweise

GenBank is a registered trademark of United States Department of Health and Human Services

Sicherheitshinweise

• Lagerklassenschlüssel: 10 - Combustible liquids
• Flammpunkt (°F): Not applicable
• Flammpunkt (°C): Not applicable
• Persönliche Schutzausrüstung: Eyeshields, Gloves, multi-purpose combination respirator cartridge (US)