WH0004093M2

Monoclonal Anti-SMAD9 antibody produced in mouse

clone 3E5, purified immunoglobulin, buffered aqueous solution

• Synonym(e): Anti-MADH6, Anti-MADH9, Anti-SMAD, mothers against DPP homolog 9 (Drosophila), Anti-SMAD8A, Anti-SMAD8B
• UNSPSC-Code: 12352203
• NACRES: NA.41

Eigenschaften

• Biologische Quelle: mouse
• Qualitätsniveau: 100
• Konjugat: unconjugated
• Antikörperform: purified immunoglobulin
• Antikörper-Produkttyp: primary antibodies
• Klon: 3E5, monoclonal
• Form: buffered aqueous solution
• Speziesreaktivität: human
• Methode(n): indirect ELISA: suitable; western blot: 1-5 μg/mL
• Isotyp: IgG2aκ
• GenBank-Hinterlegungsnummer: NM_005905
• UniProt-Hinterlegungsnummer: O15198
• Versandbedingung: dry ice
• Lagertemp.: −20°C
• Posttranslationale Modifikation Target: unmodified
• Angaben zum Gen: human ... SMAD9(4093)

Beschreibung

Allgemeine Beschreibung

SMAD family members, such as SMAD9, transduce signals from members of the TGF-beta (see TGFB1; MIM 190180) superfamily, which regulate growth, differentiation, apoptosis, and development (Nishita et al., 1999 [PubMed 10583507]).[supplied by OMIM

Immunogen

SMAD9 (NP_005896, 146 a.a. ~ 260 a.a) full length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
RHSEYNPQLSLLAKFRSASLHSEPLMPHNATYPDSFQQPPCSALPPSPSHAFSQSPCTASYPHSPGSPSEPESPYQHSDFRPVCYEEPQHWCSVAYYELNNRVGETFQASSRSVL

Physikalische Form

Solution in phosphate buffered saline, pH 7.4

Rechtliche Hinweise

GenBank is a registered trademark of United States Department of Health and Human Services

Sicherheitshinweise

• Lagerklassenschlüssel: 10 - Combustible liquids
• Flammpunkt (°F): Not applicable
• Flammpunkt (°C): Not applicable
• Persönliche Schutzausrüstung: Eyeshields, Gloves, multi-purpose combination respirator cartridge (US)