Direkt zum Inhalt
Merck

WH0000999M1

Sigma-Aldrich

Monoclonal Anti-CDH1 antibody produced in mouse

clone 3F4, purified immunoglobulin, buffered aqueous solution

Synonym(e):

Anti-Arc1, Anti-CDHE, Anti-ECAD, Anti-LCAM, Anti-UVO, Anti-cadherin 1, type 1, E-cadherin (epithelial)

Anmeldenzur Ansicht organisationsspezifischer und vertraglich vereinbarter Preise


About This Item

MDL-Nummer:
UNSPSC-Code:
12352203
NACRES:
NA.41

Biologische Quelle

mouse

Konjugat

unconjugated

Antikörperform

purified immunoglobulin

Antikörper-Produkttyp

primary antibodies

Klon

3F4, monoclonal

Form

buffered aqueous solution

Speziesreaktivität

human

Methode(n)

immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable
indirect ELISA: suitable
proximity ligation assay: suitable
western blot: 1-5 μg/mL

Isotyp

IgG1κ

GenBank-Hinterlegungsnummer

UniProt-Hinterlegungsnummer

Versandbedingung

dry ice

Lagertemp.

−20°C

Posttranslationale Modifikation Target

unmodified

Angaben zum Gen

human ... CDH1(999)

Allgemeine Beschreibung

Cadherin 1 (CDH1), a transmembrane glycoprotein is present on the epithelial cell surface. It comprises a single transmembrane region, large extracellular domain, and a short cytoplasmic domain. The CDH1 gene is mapped to human chromosome 16q22.1. It is expressed in the embryonic stage especially during lip and palate development.

Immunogen

CDH1 (NP_004351, 381 a.a. ~ 480 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
KGQVPENEANVVITTLKVTDADAPNTPAWEAVYTILNDDGGQFVVTTNPVNNDGILKTAKGLDFEAKQQYILHVAVTNVVPFEVSLTTSTATVTVDVLDV

Anwendung

Monoclonal Anti-CDH1 antibody produced in mouse has been used in immunohistochemistry and western blotting. 1:2000

Biochem./physiol. Wirkung

Cadherin 1 (CDH1) interacts with the actin cytoskeleton through its cytoplasmic domain. It plays a key role in epithelial cell-cell adhesion, maintaining tissue integrity, and migration of cells. CDH1 may also participate in the wingless (wnt) signal transduction pathway. Mutations in CDH1 are implicated in lobular breast cancer ovary cancer and blepharocheilodontic (BCD) syndrome characterized with cleft lip/palate, and ectodermal dysplasia.

Physikalische Form

Solution in phosphate buffered saline, pH 7.4

Rechtliche Hinweise

GenBank is a registered trademark of United States Department of Health and Human Services

Haftungsausschluss

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Sie haben nicht das passende Produkt gefunden?  

Probieren Sie unser Produkt-Auswahlhilfe. aus.

Empfehlung

Lagerklassenschlüssel

10 - Combustible liquids

Flammpunkt (°F)

Not applicable

Flammpunkt (°C)

Not applicable

Persönliche Schutzausrüstung

Eyeshields, Gloves, multi-purpose combination respirator cartridge (US)


Hier finden Sie alle aktuellen Versionen:

Analysenzertifikate (COA)

Lot/Batch Number

Die passende Version wird nicht angezeigt?

Wenn Sie eine bestimmte Version benötigen, können Sie anhand der Lot- oder Chargennummer nach einem spezifischen Zertifikat suchen.

Besitzen Sie dieses Produkt bereits?

In der Dokumentenbibliothek finden Sie die Dokumentation zu den Produkten, die Sie kürzlich erworben haben.

Die Dokumentenbibliothek aufrufen

D M Levi et al.
American journal of optometry and physiological optics, 53(8), 433-439 (1976-08-01)
A stratified probability sample of the Houston, Texas population was interviewed with a previously described questionnaire (Allen, D., and D. Levi, National Health and Optometry--a survey of public attitudes. Am. J. Optom., 52 (4): 291-300, (1975) to assess present opinion
C Bazzoni et al.
Minerva chirurgica, 47(15-16), 1261-1263 (1992-08-01)
The paper reports 14 cases of squamous papilloma of the esophagus which were removed using an endoscopic method: this is a comparatively rare benign pathology of which an increasing number of cases have been recently observed. Endoscopic controls were carried
José Roberto F Caldeira et al.
BMC cancer, 6, 48-48 (2006-03-04)
The E-cadherin gene (CDH1) maps, at chromosome 16q22.1, a region often associated with loss of heterozygosity (LOH) in human breast cancer. LOH at this site is thought to lead to loss of function of this tumor suppressor gene and was
Nives Pećina-Slaus
Cancer cell international, 3(1), 17-17 (2003-11-14)
E-cadherin tumor suppressor genes are particularly active area of research in development and tumorigenesis. The calcium-dependent interactions among E-cadherin molecules are critical for the formation and maintenance of adherent junctions in areas of epithelial cell-cell contact. Loss of E-cadherin-mediated-adhesion characterises
Jamal Ghoumid et al.
Genetics in medicine : official journal of the American College of Medical Genetics, 19(9), 1013-1021 (2017-03-17)
Blepharocheilodontic (BCD) syndrome is a rare autosomal dominant condition characterized by eyelid malformations, cleft lip/palate, and ectodermal dysplasia. The molecular basis of BCD syndrome remains unknown. We recruited 11 patients from 8 families and performed exome sequencing for 5 families

Unser Team von Wissenschaftlern verfügt über Erfahrung in allen Forschungsbereichen einschließlich Life Science, Materialwissenschaften, chemischer Synthese, Chromatographie, Analytik und vielen mehr..

Setzen Sie sich mit dem technischen Dienst in Verbindung.