WH0000875M1

Monoclonal Anti-CBS antibody produced in mouse

clone 3E1, purified immunoglobulin, buffered aqueous solution

• Synonym(e): Anti-HIP4, Anti-cystathionine-beta-synthase
• UNSPSC-Code: 12352203
• NACRES: NA.41

Eigenschaften

• Biologische Quelle: mouse
• Qualitätsniveau: 100
• Konjugat: unconjugated
• Antikörperform: purified immunoglobulin
• Antikörper-Produkttyp: primary antibodies
• Klon: 3E1, monoclonal
• Form: buffered aqueous solution
• Speziesreaktivität: human
• Methode(n): immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable; immunoprecipitation (IP): suitable; indirect ELISA: suitable; western blot: 1-5 μg/mL
• Isotyp: IgG2aκ
• GenBank-Hinterlegungsnummer: NM_000071
• UniProt-Hinterlegungsnummer: P35520
• Versandbedingung: dry ice
• Lagertemp.: −20°C
• Posttranslationale Modifikation Target: unmodified
• Angaben zum Gen: human ... CBS(875)

Beschreibung

Allgemeine Beschreibung

Cystathionine-β-synthase (CBS) also known as histone promoter control protein Hip4, is encoded by the gene mapped to human chromosome 21q22.3. CBS is a homotetramer containing 63kDa subunits. The encoded protein comprises C-terminal domain with a negative regulatory region, the middle domain with the catalytic core and heme-containing N-terminal domain.

The protein encoded by this gene acts as a homotetramer to catalyze the conversion of homocysteine to cystathionine, the first step in the transsulfuration pathway. The encoded protein is allosterically activated by adenosyl-methionine and uses pyridoxal phosphate as a cofactor. Defects in this gene can cause cystathionine beta-synthase deficiency (CBSD), which can lead to homocystinuria. (provided by RefSeq)

Immunogen

CBS (NP_000062, 1 a.a. ~ 100 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
MPSETPQAEVGPTGCPHRSGPHSAKGSLEKGSPEDKEAKEPLWIRPDAPSRCTWQLGRPASESPHHHTAPAKSPKILPDILKKIGDTPMVRINKIGKKFG

Biochem./physiol. Wirkung

Cystathionine-β-synthase (CBS) catalyzes the first step in the transsulfuration pathway, where serine and homocysteine is converted to cystathionine and water. In addition, it also acts as a catalyst for various alternative reactions involved in the synthesis of hydrogen sulfide, a novel neuromodulator in the brain. Deficiency of the gene is associated with the development of an autosomal recessive disorder, homocystinuria.

Physikalische Form

Solution in phosphate buffered saline, pH 7.4

Rechtliche Hinweise

GenBank is a registered trademark of United States Department of Health and Human Services

Haftungsausschluss

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Sicherheitshinweise

• Lagerklassenschlüssel: 10 - Combustible liquids
• Flammpunkt (°F): Not applicable
• Flammpunkt (°C): Not applicable
• Persönliche Schutzausrüstung: Eyeshields, Gloves, multi-purpose combination respirator cartridge (US)