Direkt zum Inhalt
Merck

WH0000142M1

Sigma-Aldrich

Monoclonal Anti-PARP1 antibody produced in mouse

clone 3G4, purified immunoglobulin, buffered aqueous solution

Synonym(e):

PARP1 Antibody - Monoclonal Anti-PARP1 antibody produced in mouse, Parp1 Antibody, Anti-ADPRT, Anti-ADPRT1, Anti-PARP, Anti-PARP1, Anti-PPOL, Anti-pADPRT1, Anti-poly (ADP-ribose) polymerase family, member 1

Anmeldenzur Ansicht organisationsspezifischer und vertraglich vereinbarter Preise


About This Item

MDL-Nummer:
UNSPSC-Code:
12352203
NACRES:
NA.41

Biologische Quelle

mouse

Qualitätsniveau

Konjugat

unconjugated

Antikörperform

purified immunoglobulin

Antikörper-Produkttyp

primary antibodies

Klon

3G4, monoclonal

Form

buffered aqueous solution

Speziesreaktivität

human

Methode(n)

indirect ELISA: suitable
indirect immunofluorescence: suitable
western blot: 1-5 μg/mL

Isotyp

IgG2aκ

GenBank-Hinterlegungsnummer

UniProt-Hinterlegungsnummer

Versandbedingung

dry ice

Lagertemp.

−20°C

Posttranslationale Modifikation Target

unmodified

Angaben zum Gen

human ... PARP1(142)

Allgemeine Beschreibung

Poly (ADP-ribose) polymerase 1 (PARP1) is a nuclear protein and belongs to the PARP family. This protein is made up of the N-terminal DNA-binding domain, central auto modification domain and C-terminal catalytic domain. PARP1 protein is located on the nucleoli. The PARP1 gene is located on the human chromosome at 1q42.12.

Immunogen

PARP1 (AAH37545, 1 a.a. ~ 100 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
MAESSDKLYRVEYAKSGRASCKKCSESIPKDSLRMAIMVQSPMFDGKVPHWYHFSCFWKVGHSIRHPDVEVDGFSELRWDDQQKVKKTAEAGGVTGKGQD

Anwendung

Monoclonal Anti-PARP1 antibody produced in mouse has been used in:
  • western blotting
  • indirect immunofluorescence
  • high-throughput cellular thermal shift assay (CESTA HT)

Biochem./physiol. Wirkung

Poly (ADP-ribose) polymerase 1 (PARP1) protein plays a role in DNA repair by catalyzing the polymerization of adenosine diphosphate (ADP)-ribose units. This protein also plays a role in the early response to DNA damage. Mutations in the PARP1 gene is associated with loss of cell viability.

Leistungsmerkmale und Vorteile

Evaluate our antibodies with complete peace of mind. If the antibody does not perform in your application, we will issue a full credit or replacement antibody. Learn more.

Physikalische Form

Solution in phosphate buffered saline, pH 7.4

Rechtliche Hinweise

GenBank is a registered trademark of United States Department of Health and Human Services

Haftungsausschluss

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Sie haben nicht das passende Produkt gefunden?  

Probieren Sie unser Produkt-Auswahlhilfe. aus.

Empfehlung

Lagerklassenschlüssel

10 - Combustible liquids

Flammpunkt (°F)

Not applicable

Flammpunkt (°C)

Not applicable

Persönliche Schutzausrüstung

Eyeshields, Gloves, multi-purpose combination respirator cartridge (US)


Hier finden Sie alle aktuellen Versionen:

Analysenzertifikate (COA)

Lot/Batch Number

Die passende Version wird nicht angezeigt?

Wenn Sie eine bestimmte Version benötigen, können Sie anhand der Lot- oder Chargennummer nach einem spezifischen Zertifikat suchen.

Besitzen Sie dieses Produkt bereits?

In der Dokumentenbibliothek finden Sie die Dokumentation zu den Produkten, die Sie kürzlich erworben haben.

Die Dokumentenbibliothek aufrufen

Yingbiao Ji et al.
Current opinion in genetics & development, 20(5), 512-518 (2010-07-02)
Cell growth and differentiation during developmental processes require the activation of many inducible genes. However, eukaryotic chromatin, which consists of DNA and histones, becomes a natural barrier impeding access to the functional transcription machinery. To break through the chromatin barrier
Joseph Shaw et al.
SLAS discovery : advancing life sciences R & D, 24(2), 121-132 (2018-12-14)
Methods to measure cellular target engagement are increasingly being used in early drug discovery. The Cellular Thermal Shift Assay (CETSA) is one such method. CETSA can investigate target engagement by measuring changes in protein thermal stability upon compound binding within
Todd A Hopkins et al.
Molecular cancer research : MCR, 17(2), 409-419 (2018-11-16)
PARP inhibitors have recently been approved as monotherapies for the treatment of recurrent ovarian cancer and metastatic BRCA-associated breast cancer, and ongoing studies are exploring additional indications and combinations with other agents. PARP inhibitors trap PARP onto damaged chromatin when
Bong-Gun Ju et al.
Cell, 119(6), 815-829 (2004-12-21)
Switching specific patterns of gene repression and activation in response to precise temporal/spatial signals is critical for normal development. Here we report a pathway in which induction of CaMKIIdelta triggers an unexpected switch in the function of the HES1 transcription
Carolina Velazquez et al.
Frontiers in oncology, 13, 1125021-1125021 (2023-04-04)
About 15% of Triple-Negative-Breast-Cancer (TNBC) present silencing of the BRCA1 promoter methylation and are assumed to be Homologous Recombination Deficient (HRD). BRCA1-methylated (BRCA1-Me) TNBC could, thus, be eligible to treatment based on PARP-inhibitors or Platinum salts. However, their actual HRD

Unser Team von Wissenschaftlern verfügt über Erfahrung in allen Forschungsbereichen einschließlich Life Science, Materialwissenschaften, chemischer Synthese, Chromatographie, Analytik und vielen mehr..

Setzen Sie sich mit dem technischen Dienst in Verbindung.