SAB2102202

Anti-SLC33A1 antibody produced in rabbit

affinity isolated antibody

• Synonym(e): Anti-ACATN, Anti-AT1, Anti-Solute carrier family 33 (acetyl-CoA transporter), member 1
• MDL-Nummer: MFCD01321727
• UNSPSC-Code: 12352203
• NACRES: NA.43

Eigenschaften

• Biologische Quelle: rabbit
• Qualitätsniveau: 100
• Konjugat: unconjugated
• Antikörperform: affinity isolated antibody
• Antikörper-Produkttyp: primary antibodies
• Klon: polyclonal
• Form: buffered aqueous solution
• Mol-Gew.: 61 kDa
• Speziesreaktivität: rat, human, mouse, horse, rabbit
• Konzentration: 0.5 mg - 1 mg/mL
• Methode(n): immunohistochemistry: suitable; western blot: suitable
• UniProt-Hinterlegungsnummer: O00400
• Versandbedingung: wet ice
• Lagertemp.: −20°C
• Posttranslationale Modifikation Target: unmodified
• Angaben zum Gen: human ... SLC33A1(9197)

Beschreibung

Immunogen

Synthetic peptide directed towards the middle region of human SLC33A1

Biochem./physiol. Wirkung

SLC33A1 is required for the formation of O-acetylated (Ac) gangliosides. It is predicted to contain 6 to 10 transmembrane domains, and a leucine zipper motif in transmembrane domain III. Studies indicate that the protein is localized to the cytoplasm.The encoded protein is required for the formation of O-acetylated (Ac) gangliosides. It is predicted to contain 6 to 10 transmembrane domains, and a leucine zipper motif in transmembrane domain III. Studies indicate that the protein is localized to the cytoplasm.

Sequenz

Synthetic peptide located within the following region: CNSVGQTAGYFLGNVLFLALESADFCNKYLRFQPQPRGIVTLSDFLFFWG

Physikalische Form

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Haftungsausschluss

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Sicherheitshinweise

• Lagerklassenschlüssel: 10 - Combustible liquids
• WGK: WGK 3
• Flammpunkt (°F): Not applicable
• Flammpunkt (°C): Not applicable