SAB2101422

Anti-MAN1A2 antibody produced in rabbit

affinity isolated antibody

• Synonym(e): Anti-MAN1B, Anti-Mannosidase, α, class 1A, member 2
• UNSPSC-Code: 12352203
• NACRES: NA.41

Eigenschaften

• Biologische Quelle: rabbit
• Qualitätsniveau: 100
• Konjugat: unconjugated
• Antikörperform: affinity isolated antibody
• Antikörper-Produkttyp: primary antibodies
• Klon: polyclonal
• Form: buffered aqueous solution
• Mol-Gew.: 73 kDa
• Speziesreaktivität: bovine, mouse, rabbit, human, horse, dog, rat, guinea pig
• Konzentration: 0.5 mg - 1 mg/mL
• Methode(n): western blot: suitable
• UniProt-Hinterlegungsnummer: O60476
• Versandbedingung: wet ice
• Lagertemp.: −20°C
• Posttranslationale Modifikation Target: unmodified
• Angaben zum Gen: human ... MAN1A2(10905)

Beschreibung

Immunogen

Synthetic peptide directed towards the middle region of human MAN1A2

Biochem./physiol. Wirkung

Alpha-mannosidases function at different stages of N-glycan maturation in mammalian cells. See MAN2A1 (MIM 154582) for general information.Alpha-mannosidases function at different stages of N-glycan maturation in mammalian cells. See MAN2A1 (MIM 154582) for general information.[supplied by OMIM]. PRIMARYREFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP 1-597 BC052954.1 17-613 598-1023 AU133800.1 118-543 1024-2908 AF027156.1 823-2707 2909-3316 BC052954.1 2925-3332 3317-4416 BC063300.1 3315-4414 4417-5388 BC052954.1 4432-5403

Sequenz

Synthetic peptide located within the following region: FALGADGSRADKAGHYLELGAEIARTCHESYDRTALKLGPESFKFDGAVE

Physikalische Form

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Haftungsausschluss

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Sicherheitshinweise

• Lagerklassenschlüssel: 10 - Combustible liquids
• WGK: WGK 3
• Flammpunkt (°F): Not applicable
• Flammpunkt (°C): Not applicable