SAB1411338

Anti-TDO2 antibody produced in rabbit

purified immunoglobulin, buffered aqueous solution

• Synonym(e): TDO, TPH2, TRPO
• UNSPSC-Code: 12352203
• NACRES: NA.41

Eigenschaften

• Biologische Quelle: rabbit
• Qualitätsniveau: 100
• Konjugat: unconjugated
• Antikörperform: purified immunoglobulin
• Antikörper-Produkttyp: primary antibodies
• Klon: polyclonal
• Form: buffered aqueous solution
• Mol-Gew.: antigen 47.9 kDa
• Speziesreaktivität: human
• Methode(n): western blot: 1 μg/mL
• NCBI-Hinterlegungsnummer: NM_005651.1
• UniProt-Hinterlegungsnummer: P48775
• Versandbedingung: dry ice
• Lagertemp.: −20°C
• Posttranslationale Modifikation Target: unmodified
• Angaben zum Gen: human ... TDO2(6999)

Beschreibung

Allgemeine Beschreibung

Tryptophan 2,3-dioxygenase (EC 1.13.11.11) plays a role in catalyzing the first and rat-limiting step in the kynurenine pathway, the major pathway of tryptophan metabolism.[supplied by OMIM

Immunogen

TDO2 (NP_005642.1, 1 a.a. ~ 406 a.a) full-length human protein.

Sequence
MSGCPFLGNNFGYTFKKLPVEGSEEDKSQTGVNRASKGGLIYGNYLHLEKVLNAQELQSETKGNKIHDEHLFIITHQAYELWFKQILWELDSVREIFQNGHVRDERNMLKVVSRMHRVSVILKLLVQQFSILETMTALDFNDFREYLSPASGFQSLQFRLLENKIGVLQNMRVPYNRRHYRDNFKGEENELLLKSEQEKTLLELVEAWLERTPGLEPHGFNFWGKLEKNITRGLEEEFIRIQAKEESEEKEEQVAEFQKQKEVLLSLFDEKRHEHLLSKGERRLSYRALQGALMIYFYREEPRFQVPFQLLTSLMDIDSLMTKWRYNHVCMVHRMLGSKAGTGGSSGYHYLRSTVSDRYKVFVDLFNLSTYLIPRHWIPKMNPTIHKFLYTAEYCDSSYFSSDESD

Biochem./physiol. Wirkung

TDO2 (tryptophan 2, 3-dioxygenase) is responsible for the cleavage of indole ring at the C2-C3 bond of L-tryptophan, thereby regulating tryptophan concentration. It is expressed in tumor cells and suppresses antitumor immune responses. During acute ethanol intake, TDO2 carries the kynurenine pathway via glucocorticoid-associated route. This can lead to the accumulation of neurotoxic metabolites along with the reduction of serotonin. The TDO2 gene is upregulated in brains of patients with Alzheimer′s disease and might be associated with making of neurofibrillary tangles and senile plaque. TDO2 is also responsible for antimicrobial and immunoregulatory activities.

Physikalische Form

Solution in phosphate buffered saline, pH 7.4

Haftungsausschluss

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Sicherheitshinweise

• Lagerklassenschlüssel: 10 - Combustible liquids
• WGK: WGK 3
• Flammpunkt (°F): Not applicable
• Flammpunkt (°C): Not applicable