SAB1410166

Anti-NUDT5 antibody produced in rabbit

purified immunoglobulin, buffered aqueous solution

• Synonym(e): YSA1, YSA1H, hYSAH1
• UNSPSC-Code: 12352203
• NACRES: NA.41

Eigenschaften

• Biologische Quelle: rabbit
• Konjugat: unconjugated
• Antikörperform: purified immunoglobulin
• Antikörper-Produkttyp: primary antibodies
• Klon: polyclonal
• Form: buffered aqueous solution
• Mol-Gew.: antigen 24.3 kDa
• Speziesreaktivität: human
• Methode(n): immunofluorescence: suitable; western blot: 1 μg/mL
• NCBI-Hinterlegungsnummer: NM_014142.2
• UniProt-Hinterlegungsnummer: Q9UKK9
• Versandbedingung: dry ice
• Lagertemp.: −20°C
• Posttranslationale Modifikation Target: unmodified
• Angaben zum Gen: human ... NUDT5(11164)

Beschreibung

Allgemeine Beschreibung

Nudix hydrolases, such as NUDT5, eliminate toxic nucleotide derivatives from the cell and regulate the levels of important signaling nucleotides and their metabolites (McLennan, 1999 [PubMed 10373642]).[supplied by OMIM

Immunogen

NUDT5 (NP_054861.2, 1 a.a. ~ 219 a.a) full-length human protein.

Sequence
MESQEPTESSQNGKQYIISEELISEGKWVKLEKTTYMDPTGKTRTWESVKRTTRKEQTADGVAVIPVLQRTLHYECIVLVKQFRPPMGGYCIEFPAGLIDDGETPEAAALRELEEETGYKGDIAECSPAVCMDPGLSNCTIHIVTVTINGDDAENARPKPKPGDGEFVEVISLPKNDLLQRLDALVAEEHLTVDARVYSYALALKHANAKPFEVPFLKF

Biochem./physiol. Wirkung

NUDT5 (Nudix, nucleoside diphosphate linked moiety X-type motif 5) is mainly involved in maintaining the intracellular level of ADP-ribose by hydrolyzing ADP-ribose (ADPR) to AMP and ribose 5′-phosphate. It also restricts non-enzymatic ADP-ribosylation. Its N-terminal antiparallel β-sheet plays an important role in dimerization, which is essential for substrate recognition and enzymatic activity. NUDT5 has also been predicted for altered cell proliferation. It has been suggested that cells with suppressed NUDT5 shows delayed cell cycle G1 phase. Thus, it has been concluded that NUDT5 may involve in cell growth and cell cycle proliferation by regulating G1-S transition in mammalian cells.

Physikalische Form

Solution in phosphate buffered saline, pH 7.4

Sicherheitshinweise

• Lagerklassenschlüssel: 10 - Combustible liquids
• WGK: WGK 3
• Flammpunkt (°F): Not applicable
• Flammpunkt (°C): Not applicable