SAB1405127

Monoclonal Anti-EXOSC4, (N-terminal) antibody produced in mouse

clone 4F9, purified immunoglobulin, buffered aqueous solution

• Synonym(e): FLJ20591, RRP41, RRP41A, Rrp41p, SKI6, Ski6p, hRrp41p, p12A
• UNSPSC-Code: 12352203
• NACRES: NA.41

Eigenschaften

• Biologische Quelle: mouse
• Qualitätsniveau: 100
• Konjugat: unconjugated
• Antikörperform: purified immunoglobulin
• Antikörper-Produkttyp: primary antibodies
• Klon: 4F9, monoclonal
• Form: buffered aqueous solution
• Mol-Gew.: antigen ~37.11 kDa
• Speziesreaktivität: human
• Methode(n): capture ELISA: suitable; indirect ELISA: suitable; western blot: 1-5 μg/mL
• Isotyp: IgG2aκ
• NCBI-Hinterlegungsnummer: NM_019037
• UniProt-Hinterlegungsnummer: Q9NPD3
• Versandbedingung: dry ice
• Lagertemp.: −20°C
• Posttranslationale Modifikation Target: unmodified
• Angaben zum Gen: human ... EXOSC4(54512)

Beschreibung

Allgemeine Beschreibung

Mouse monoclonal antibody raised against a partial recombinant EXOSC4.
The gene EXOSC4 (exosome component 4) is mapped to human chromosome 8q24.3. The encoded protein is present in the cytoplasm as well as nucleus and has a RNase pleckstrin homology (PH) domain.

Immunogen

EXOSC4 (NP_061910.1, 1 a.a. ~ 100 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
MAGLELLSDQGYRVDGRRAGELRKIQARMGVFAQADGSAYIEQGNTKALAVVYGPHEIRGSRARALPDRALVNCQYSSATFSTGERKRRPHGDRKSCEMG

Biochem./physiol. Wirkung

EXOSC4 (exosome component 4) is a core component of the exosome complex and is required for the stability of the complex. The exosome complex exhibits 3′-5′ exoribonuclease function. EXOSC4 lacks ribonuclease activity but is involved in mRNA turnover.

Physikalische Form

Solution in phosphate buffered saline, pH 7.4

Sicherheitshinweise

• Lagerklassenschlüssel: 10 - Combustible liquids
• WGK: WGK 1
• Flammpunkt (°F): Not applicable
• Flammpunkt (°C): Not applicable