SAB1401383
Anti-TFAM antibody produced in rabbit
purified immunoglobulin, buffered aqueous solution
Synonym(e):
MtTF1, TCF6, TCF6L1, TCF6L2, TCF6L3, mtTFA
Anmeldenzur Ansicht organisationsspezifischer und vertraglich vereinbarter Preise
Alle Fotos(2)
About This Item
UNSPSC-Code:
12352203
NACRES:
NA.41
Empfohlene Produkte
Biologische Quelle
rabbit
Konjugat
unconjugated
Antikörperform
purified immunoglobulin
Antikörper-Produkttyp
primary antibodies
Klon
polyclonal
Form
buffered aqueous solution
Speziesreaktivität
mouse, human
Methode(n)
western blot: 1 μg/mL
NCBI-Hinterlegungsnummer
UniProt-Hinterlegungsnummer
Versandbedingung
dry ice
Lagertemp.
−20°C
Posttranslationale Modifikation Target
unmodified
Angaben zum Gen
human ... TFAM(7019)
Allgemeine Beschreibung
Mitochondrial transcription factor A (TFAM) is a high-mobility group (HMG) protein and is made up of two HMG-box domains. The TFAM gene is located on the human chromosome at 10q21.1.
Immunogen
TFAM (NP_003192.1, 1 a.a. ~ 246 a.a) full-length human protein.
Sequence
MAFLRSMWGVLSALGRSGAELCTGCGSRLRSPFSFVYLPRWFSSVLASCPKKPVSSYLRFSKEQLPIFKAQNPDAKTTELIRRIAQRWRELPDSKKKIYQDAYRAEWQVYKEEISRFKEQLTPSQIMSLEKEIMDKHLKRKAMTKKKELTLLGKPKRPRSAYNVYVAERFQEAKGDSPQEKLKTVKENWKNLSDSEKELYIQHAKEDETRYHNEMKSWEEQMIEVGRKDLLRRTIKKQRKYGAEEC
Sequence
MAFLRSMWGVLSALGRSGAELCTGCGSRLRSPFSFVYLPRWFSSVLASCPKKPVSSYLRFSKEQLPIFKAQNPDAKTTELIRRIAQRWRELPDSKKKIYQDAYRAEWQVYKEEISRFKEQLTPSQIMSLEKEIMDKHLKRKAMTKKKELTLLGKPKRPRSAYNVYVAERFQEAKGDSPQEKLKTVKENWKNLSDSEKELYIQHAKEDETRYHNEMKSWEEQMIEVGRKDLLRRTIKKQRKYGAEEC
Anwendung
Anti-TFAM antibody produced in rabbit has been used in western blotting (1:1000) and immunofluorescence.
Biochem./physiol. Wirkung
Mitochondrial transcription factor A (TFAM) is involved in mitochondrial DNA (mtDNA) synthesis, expression, and packaging. It is also involved in regulating the aggregation of mtDNA. TFAM stabilizes the mtDNA by binding to it in a sequence-depending manner and forms a nucleoid.
Physikalische Form
Solution in phosphate buffered saline, pH 7.4
Haftungsausschluss
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
Sie haben nicht das passende Produkt gefunden?
Probieren Sie unser Produkt-Auswahlhilfe. aus.
Lagerklassenschlüssel
10 - Combustible liquids
Flammpunkt (°F)
Not applicable
Flammpunkt (°C)
Not applicable
Analysenzertifikate (COA)
Suchen Sie nach Analysenzertifikate (COA), indem Sie die Lot-/Chargennummer des Produkts eingeben. Lot- und Chargennummern sind auf dem Produktetikett hinter den Wörtern ‘Lot’ oder ‘Batch’ (Lot oder Charge) zu finden.
Besitzen Sie dieses Produkt bereits?
In der Dokumentenbibliothek finden Sie die Dokumentation zu den Produkten, die Sie kürzlich erworben haben.
Maik Hüttemann et al.
Clinical science (London, England : 1979), 124(11), 663-674 (2012-12-21)
Alternative approaches to reduce congenital muscle dysfunction are needed in cases where the ability to exercise is limited. (-)-Epicatechin is found in cocoa and may stimulate capillarity and mitochondrial proliferation in skeletal muscle. A total of 21 male rats bred
Victoria Alvarez et al.
Journal of Alzheimer's disease : JAD, 13(3), 275-280 (2008-04-24)
Impaired mitochondrial function and an increased number of mutations in mitochondrial DNA (mtDNA) has been found in brains of patients with late-onset Alzheimer's disease (LOAD). The TFAM-gene encodes the mitochondrial transcription factor A, a protein that controls the transcription, replication
Ryan Neil Marshall et al.
Frontiers in physiology, 13, 1097988-1097988 (2023-01-24)
Background: Ageing is associated with alterations to skeletal muscle oxidative metabolism that may be influenced by physical activity status, although the mechanisms underlying these changes have not been unraveled. Similarly, the effect of resistance exercise training (RET) on skeletal muscle
Leonardo Nogueira et al.
The Journal of physiology, 589(Pt 18), 4615-4631 (2011-07-27)
The flavanol (-)-epicatechin, a component of cacao (cocoa), has been shown to have multiple health benefits in humans. Using 1-year-old male mice, we examined the effects of 15 days of (-)-epicatechin treatment and regular exercise on: (1) exercise performance, (2)
Yoshiyuki Ikeda et al.
Circulation research, 116(2), 264-278 (2014-10-22)
Both fusion and fission contribute to mitochondrial quality control. How unopposed fusion affects survival of cardiomyocytes and left ventricular function in the heart is poorly understood. We investigated the role of dynamin-related protein 1 (Drp1), a GTPase that mediates mitochondrial
Unser Team von Wissenschaftlern verfügt über Erfahrung in allen Forschungsbereichen einschließlich Life Science, Materialwissenschaften, chemischer Synthese, Chromatographie, Analytik und vielen mehr..
Setzen Sie sich mit dem technischen Dienst in Verbindung.