Direkt zum Inhalt
Merck

HPA048198

Sigma-Aldrich

Anti-FAN1 antibody produced in rabbit

Prestige Antibodies® Powered by Atlas Antibodies, affinity isolated antibody

Synonym(e):

KIAA1018, MTMR15

Anmeldenzur Ansicht organisationsspezifischer und vertraglich vereinbarter Preise


About This Item

UNSPSC-Code:
12352203
Human Protein Atlas-Nummer:
NACRES:
NA.41

Biologische Quelle

rabbit

Qualitätsniveau

Konjugat

unconjugated

Antikörperform

affinity isolated antibody

Antikörper-Produkttyp

primary antibodies

Klon

polyclonal

Produktlinie

Prestige Antibodies® Powered by Atlas Antibodies

Form

buffered aqueous glycerol solution

Speziesreaktivität

human

Methode(n)

immunofluorescence: 0.25-2 μg/mL

Immunogene Sequenz

RFTSLQQAQDLVSCLGGPVLSGVCRHLAADFRHCRGGLPDLVVWNSQSRHFKLVEVKGPNDRLSHKQMIWLAELQKLGAEVEVCHVVAVG

UniProt-Hinterlegungsnummer

Versandbedingung

wet ice

Lagertemp.

−20°C

Posttranslationale Modifikation Target

unmodified

Angaben zum Gen

human ... FAN1(22909)

Allgemeine Beschreibung

Fanconi-associated nuclease 1 (FAN1) encodes DNA repair nuclease, which is necessary for interstrand cross link DNA repair. The gene FAN1 is located on human chromosome 15q13.3.

Immunogen

FANCD2/FANCI-associated nuclease 1

Anwendung

All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the industry.

The Human Protein Atlas project can be subdivided into three efforts: Human Tissue Atlas, Cancer Atlas, and Human Cell Atlas. The antibodies that have been generated in support of the Tissue and Cancer Atlas projects have been tested by immunohistochemistry against hundreds of normal and disease tissues and through the recent efforts of the Human Cell Atlas project, many have been characterized by immunofluorescence to map the human proteome not only at the tissue level but now at the subcellular level. These images and the collection of this vast data set can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. We also provide Prestige Antibodies® protocols and other useful information.
Anti-FAN1 antibody recognises FAN1 protein.

Biochem./physiol. Wirkung

Fanconi-associated nuclease 1 (FAN1) has 5′ flap endonuclease and 5′-3′ exonuclease activity. Mutations in FAN1 gene causes Fanconi anaemia, which is a bone marrow failure disorder, associated with chromosome fragility and vulnerability to cancer. Aberrations in FAN1 leads to improper DNA repair and causes psychiatric and neurodevelopmental disorders like schizophrenia and autism.(2) Mutations in FAN1 is linked to karyomegalic interstitial nephritis (KIN) in kidney. It is also related to hereditary colorectal cancer.

Leistungsmerkmale und Vorteile

Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.

Every Prestige Antibody is tested in the following ways:
  • IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
  • Protein array of 364 human recombinant protein fragments.

Verlinkung

Corresponding Antigen APREST91131

Physikalische Form

Solution in phosphate buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide.

Rechtliche Hinweise

Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany

Sie haben nicht das passende Produkt gefunden?  

Probieren Sie unser Produkt-Auswahlhilfe. aus.

Lagerklassenschlüssel

10 - Combustible liquids

WGK

WGK 1

Flammpunkt (°F)

Not applicable

Flammpunkt (°C)

Not applicable


Analysenzertifikate (COA)

Suchen Sie nach Analysenzertifikate (COA), indem Sie die Lot-/Chargennummer des Produkts eingeben. Lot- und Chargennummern sind auf dem Produktetikett hinter den Wörtern ‘Lot’ oder ‘Batch’ (Lot oder Charge) zu finden.

Besitzen Sie dieses Produkt bereits?

In der Dokumentenbibliothek finden Sie die Dokumentation zu den Produkten, die Sie kürzlich erworben haben.

Die Dokumentenbibliothek aufrufen

Scan statistic-based analysis of exome sequencing data identifies FAN1 at 15q13.3 as a susceptibility gene for schizophrenia and autism
Ionita-Laza I, et al.
Proceedings of the National Academy of Sciences of the USA, 111(1), 343-348 (2014)
KIAA1018/FAN1 nuclease protects cells against genomic instability induced by interstrand cross-linking agents
Yoshikiyo K, et al.
Proceedings of the National Academy of Sciences of the USA, 107(50), 21553-21557 (2010)
FAN1 mutations cause karyomegalic interstitial nephritis, linking chronic kidney failure to defective DNA damage repair
Zhou W, et al.
Proceedings of the National Academy of Sciences of the USA, 44(8), 910-910 (2012)
On the role of FAN1 in Fanconi anemia
Trujillo JP, et al.
Blood, blood-b2012 (2012)
Fanconi anemia: a model disease for studies on human genetics and advanced therapeutics
Bogliolo M and Surralles J
Current Opinion in Genetics & Development, 33(3), 32-40 (2015)

Unser Team von Wissenschaftlern verfügt über Erfahrung in allen Forschungsbereichen einschließlich Life Science, Materialwissenschaften, chemischer Synthese, Chromatographie, Analytik und vielen mehr..

Setzen Sie sich mit dem technischen Dienst in Verbindung.