Direkt zum Inhalt
Merck

HPA043420

Sigma-Aldrich

Anti-UMOD antibody produced in rabbit

enhanced validation

Prestige Antibodies® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution

Synonym(e):

Anti-ADMCKD2, Anti-ADTKD1, Anti-FJHN, Anti-HNFJ, Anti-HNFJ1, Anti-MCKD2, Anti-THGP, Anti-THP

Anmeldenzur Ansicht organisationsspezifischer und vertraglich vereinbarter Preise


About This Item

UNSPSC-Code:
12352203
Human Protein Atlas-Nummer:
NACRES:
NA.41

Biologische Quelle

rabbit

Konjugat

unconjugated

Antikörperform

affinity isolated antibody

Antikörper-Produkttyp

primary antibodies

Klon

polyclonal

Produktlinie

Prestige Antibodies® Powered by Atlas Antibodies

Form

buffered aqueous glycerol solution

Speziesreaktivität

human

Erweiterte Validierung

orthogonal RNAseq
independent
Learn more about Antibody Enhanced Validation

Methode(n)

immunohistochemistry: 1:1000-1:2500

Immunogene Sequenz

GYYVYNLTAPPECHLAYCTDPSSVEGTCEECSIDEDCKSNNGRWHCQCKQDFNITDISLLEHRLECGANDMKVSLGK

UniProt-Hinterlegungsnummer

Versandbedingung

wet ice

Lagertemp.

−20°C

Posttranslationale Modifikation Target

unmodified

Angaben zum Gen

human ... UMOD(7369)

Allgemeine Beschreibung

Uromodulin (UMOD) is a glycoprotein produced particularly in renal tubular cells and released into urine. The gene is located on human chromosome 16p12.3. It is the most abundant protein in urine.

Immunogen

uromodulin

Anwendung

All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the industry.

The Human Protein Atlas project can be subdivided into three efforts: Human Tissue Atlas, Cancer Atlas, and Human Cell Atlas. The antibodies that have been generated in support of the Tissue and Cancer Atlas projects have been tested by immunohistochemistry against hundreds of normal and disease tissues and through the recent efforts of the Human Cell Atlas project, many have been characterized by immunofluorescence to map the human proteome not only at the tissue level but now at the subcellular level. These images and the collection of this vast data set can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. We also provide Prestige Antibodies® protocols and other useful information.

Biochem./physiol. Wirkung

Uromodulin (UMOD) plays an important role in inflammatory responses and acts as a potential therapeutic for hypertension. It provides innate immunity and protects from kidney stones. The protein provides protection from uropathogenic bacteria. Mutations in this gene is associated with inflammation and development of kidney diseases, such as medullary cystic kidney disease 2 (MCKD2), glomerulocystic kidney disease with hyperuricemia and isosthenuria (GCKDHI) and familial juvenile hyperuricemic nephropathy (FJHN).

Leistungsmerkmale und Vorteile

Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.

Every Prestige Antibody is tested in the following ways:
  • IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
  • Protein array of 364 human recombinant protein fragments.

Verlinkung

Corresponding Antigen APREST82316

Physikalische Form

Solution in phosphate buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide.

Rechtliche Hinweise

Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany

Haftungsausschluss

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Sie haben nicht das passende Produkt gefunden?  

Probieren Sie unser Produkt-Auswahlhilfe. aus.

Lagerklassenschlüssel

10 - Combustible liquids

WGK

WGK 1


Hier finden Sie alle aktuellen Versionen:

Analysenzertifikate (COA)

Lot/Batch Number

Die passende Version wird nicht angezeigt?

Wenn Sie eine bestimmte Version benötigen, können Sie anhand der Lot- oder Chargennummer nach einem spezifischen Zertifikat suchen.

Besitzen Sie dieses Produkt bereits?

In der Dokumentenbibliothek finden Sie die Dokumentation zu den Produkten, die Sie kürzlich erworben haben.

Die Dokumentenbibliothek aufrufen

A structured interdomain linker directs self-polymerization of human uromodulin
Bokhove M, et al.
Proceedings of the National Academy of Sciences of the USA, 113(6), 1552-1557 (2016)
Uromodulin rs4293393 T> C variation is associated with kidney disease in patients with type 2 diabetes
Kumar V, et al.
The Indian Journal of Medical Research, 146(2), S15-S15 (2017)
Unravelling the genetic basis of renal diseases; from single gene to multifactorial disorders
Kumar V, et al.
The Journal of Pathology, 146(Suppl 2), S15-S15 (2017)
Modulation of urinary peptidome in humans exposed to high altitude hypoxia
Mainini V, et al.
Molecular Biosystems, 8(4), 959-966 (2012)
Functional analysis of UMOD gene and its effect on inflammatory cytokines in serum of essential hypertension patients
Jian L, et al.
International Journal of Clinical and Experimental Pathology, 8(9), 11356-11356 (2015)

Unser Team von Wissenschaftlern verfügt über Erfahrung in allen Forschungsbereichen einschließlich Life Science, Materialwissenschaften, chemischer Synthese, Chromatographie, Analytik und vielen mehr..

Setzen Sie sich mit dem technischen Dienst in Verbindung.