HPA040465

Anti-PLAC8 antibody produced in rabbit

Prestige Antibodies^® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution

• Synonym(e): Anti-C15, Anti-Onzin, Anti-Placenta-specific 8
• UNSPSC-Code: 12352203
• Human Protein Atlas-Nummer: HPA040465

Eigenschaften

• Biologische Quelle: rabbit
• Qualitätsniveau: 100
• Konjugat: unconjugated
• Antikörperform: affinity isolated antibody
• Antikörper-Produkttyp: primary antibodies
• Klon: polyclonal
• Produktlinie: Prestige Antibodies^® Powered by Atlas Antibodies
• Form: buffered aqueous glycerol solution
• Speziesreaktivität: human
• Methode(n): immunoblotting: 0.04-0.4 μg/mL; immunohistochemistry: 1:1000-1:2500
• Immunogene Sequenz: MQAQAPVVVVTQPGVGPGPAPQNSNWQTGMCDCFSDCGVCLCGTFCFPCLGCQVAADMNECCLCGTSVAMRTLYRTRYGIPGSICDDYMATLCCPHCTLCQIKRDINRRRAMRTF
• UniProt-Hinterlegungsnummer: Q9NZF1
• Versandbedingung: wet ice
• Lagertemp.: −20°C
• Posttranslationale Modifikation Target: unmodified
• Angaben zum Gen: human ... PLAC8(51316)

Beschreibung

Allgemeine Beschreibung

Placenta specific 8 (PLAC8), also known as onzin, is encoded by the gene mapped to human chromosome 4q21.23. PLAC8 is a 12.5kDa, 112 amino acid protein characterized with a cysteine-rich domain.

Immunogen

placenta-specific 8 recombinant protein epitope signature tag (PrEST)

Anwendung

Applications in which this antibody has been used successfully, and the associated peer-reviewed papers, are given below.
Western Blotting (1 paper) and is also used in immunohistochemical staining.

Biochem./physiol. Wirkung

Placenta specific 8 (PLAC8) plays a vital role in the regulation of brown adipocyte differentiation and function. Decreased expression of PLAC8 enhances the activity of phosphoinositide 3-kinase (PI3K)/Akt/glycogen synthase kinase 3 β (GSK3β) and Wnt/β-catenin signaling pathway to stimulate hepatocellular carcinoma cell proliferation. PLAC8 is highly expressed ectopically in advanced preneoplastic lesions and invasive human pancreatic ductal adenocarcinoma (PDAC). Thus, it can be considered as a potential diagnostic and therapeutic target for pancreatic cancer.

Leistungsmerkmale und Vorteile

Prestige Antibodies^® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies^® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.

Every Prestige Antibody is tested in the following ways:

• IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
• Protein array of 364 human recombinant protein fragments.

Verlinkung

Corresponding Antigen APREST70157

Physikalische Form

Solution in phosphate buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide.

Rechtliche Hinweise

Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany

Haftungsausschluss

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Sicherheitshinweise

• Lagerklassenschlüssel: 10 - Combustible liquids
• WGK: WGK 1
• Flammpunkt (°F): Not applicable
• Flammpunkt (°C): Not applicable