Direkt zum Inhalt
Merck

HPA038356

Sigma-Aldrich

Anti-PCBP2 antibody produced in rabbit

Prestige Antibodies® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution

Synonym(e):

Anti-HNRNPE2, Anti-HNRPE2, Anti-hnRNP-E2

Anmeldenzur Ansicht organisationsspezifischer und vertraglich vereinbarter Preise


About This Item

UNSPSC-Code:
12352203
Human Protein Atlas-Nummer:
NACRES:
NA.41

Biologische Quelle

rabbit

Qualitätsniveau

Konjugat

unconjugated

Antikörperform

affinity isolated antibody

Antikörper-Produkttyp

primary antibodies

Klon

polyclonal

Produktlinie

Prestige Antibodies® Powered by Atlas Antibodies

Form

buffered aqueous glycerol solution

Speziesreaktivität

human

Methode(n)

immunofluorescence: 0.25-2 μg/mL
immunohistochemistry: 1:20-1:50

Immunogene Sequenz

IFAGGQDRYSTGSDSASFPHTTPSMCLNPDLEG

UniProt-Hinterlegungsnummer

Versandbedingung

wet ice

Lagertemp.

−20°C

Posttranslationale Modifikation Target

unmodified

Angaben zum Gen

human ... PCBP2(5094)

Allgemeine Beschreibung

Poly (rC) binding protein 2 (PCBP2), also known as heterogeneous ribonuclear protein E2 (hnRNP E2) and αCP2, belongs to a group of proteins that bind to poly(C) stretches of both RNA and DNA and is encoded by the gene mapped to human chromosome 12q13.13. The encoded protein is a key constituent of stress granules (SG) and processing bodies (P-body). The protein shuttles between cytoplasm and nucleus.

Immunogen

poly(rC) binding protein 2 recombinant protein epitope signature tag (PrEST)

Anwendung

All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the industry. The Human Protein Atlas project can be subdivided into three efforts: Human Tissue Atlas, Cancer Atlas, and Human Cell Atlas. The antibodies that have been generated in support of the Tissue and Cancer Atlas projects have been tested by immunohistochemistry against hundreds of normal and disease tissues and through the recent efforts of the Human Cell Atlas project, many have been characterized by immunofluorescence to map the human proteome not only at the tissue level but now at the subcellular level. These images and the collection of this vast data set can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. We also provide Prestige Antibodies® protocols and other useful information.
Anti-PCBP2 antibody produced in rabbit has been used in fully automated and standardized-individual-nucleotide resolution cross-linking and immunoprecipitation (FAST- iCLIP).

Biochem./physiol. Wirkung

Poly (rC) binding protein 2 (PCBP2) plays a vital role in controlling mRNA stability and regulating translation 14. In addition, it can also take part in protein-protein interactions. The encoded protein functions as a negative regulator of mitochondrial antiviral-signaling protein (MAVS)-mediated antiviral signaling via interacting with HECT (homologous to the E6-AP carboxyl terminus) domain -containing E3 ligase AIP4. Dysregulated expression of the gene results in oral cancer. PCBP2 plays a vital role as an initiator of internal ribosomal entry site (IRES)-mediated translation of both viral and cellular mRNA. Additionally, it also facilitates many biological processes, such as transcriptional regulation and translational silencing. Elevated expression of PCBP2 has been observed in human glioma tissues and cell lines. Downregulation of this gene, by the inhibition of cell-cycle progression and activation of caspase-3–mediated apoptosis, retards glioma growth in vitro and in vivo.

Leistungsmerkmale und Vorteile

Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.

Every Prestige Antibody is tested in the following ways:
  • IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
  • Protein array of 364 human recombinant protein fragments.

Verlinkung

Corresponding Antigen APREST81245

Physikalische Form

Solution in phosphate buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide.

Rechtliche Hinweise

Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany

Haftungsausschluss

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Sie haben nicht das passende Produkt gefunden?  

Probieren Sie unser Produkt-Auswahlhilfe. aus.

Lagerklassenschlüssel

10 - Combustible liquids

WGK

WGK 1

Flammpunkt (°F)

Not applicable

Flammpunkt (°C)

Not applicable


Hier finden Sie alle aktuellen Versionen:

Analysenzertifikate (COA)

Lot/Batch Number

Die passende Version wird nicht angezeigt?

Wenn Sie eine bestimmte Version benötigen, können Sie anhand der Lot- oder Chargennummer nach einem spezifischen Zertifikat suchen.

Besitzen Sie dieses Produkt bereits?

In der Dokumentenbibliothek finden Sie die Dokumentation zu den Produkten, die Sie kürzlich erworben haben.

Die Dokumentenbibliothek aufrufen

Common Dysregulated Genes in Endometriosis and Malignancies.
Dentillo DB
Revista Brasileira de Ginecologia e obstetricia : Revista da Federac?o Brasileira das Sociedades de Ginecologia e Obstetricia, 38, 253-262 (2016)
RNA-binding protein PCBP2 modulates glioma growth by regulating FHL3.
Han W
The Journal of Clinical Investigation, 123, 2103-2118 (2013)
Dissecting noncoding and pathogen RNA-protein interactomes.
Flynn RA
RNA, 21, 135-143 (2015)
Ryan A Flynn et al.
RNA (New York, N.Y.), 21(1), 135-143 (2014-11-21)
RNA-protein interactions are central to biological regulation. Cross-linking immunoprecipitation (CLIP)-seq is a powerful tool for genome-wide interrogation of RNA-protein interactomes, but current CLIP methods are limited by challenging biochemical steps and fail to detect many classes of noncoding and nonhuman
PCBP2 mediates degradation of the adaptor MAVS via the HECT ubiquitin ligase AIP4.
You F
Nature Immunology, 10, 1300-1308 (2009)

Global Trade Item Number

SKUGTIN
HPA038356-25UL4061842938230
HPA038356-100UL4061836356828

Unser Team von Wissenschaftlern verfügt über Erfahrung in allen Forschungsbereichen einschließlich Life Science, Materialwissenschaften, chemischer Synthese, Chromatographie, Analytik und vielen mehr..

Setzen Sie sich mit dem technischen Dienst in Verbindung.