HPA028897

Anti-SMAD7 antibody produced in rabbit

Prestige Antibodies^® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution

• Synonym(e): Anti-MADH7, Anti-MADH8, Anti-SMAD family member 7
• UNSPSC-Code: 12352203
• Human Protein Atlas-Nummer: HPA028897
• NACRES: NA.41

Eigenschaften

• Biologische Quelle: rabbit
• Konjugat: unconjugated
• Antikörperform: affinity isolated antibody
• Antikörper-Produkttyp: primary antibodies
• Klon: polyclonal
• Produktlinie: Prestige Antibodies^® Powered by Atlas Antibodies
• Form: buffered aqueous glycerol solution
• Speziesreaktivität: human
• Erweiterte Validierung: orthogonal RNAseq; Learn more about Antibody Enhanced Validation
• Methode(n): immunofluorescence: 0.25-2 μg/mL; immunohistochemistry: 1:50-1:200
• Immunogene Sequenz: EVKRLCCCESYGKINPELVCCNPHHLSRLCELESPPPPYSRYPMDFLKPTADCPDAVPSSAETGGTNYLAPGGLSDSQLLLEPGDRSHWCVVAYWEEKTRVGRLYCVQEPSLDIFYDLPQGNG
• UniProt-Hinterlegungsnummer: O15105
• Versandbedingung: wet ice
• Lagertemp.: −20°C
• Posttranslationale Modifikation Target: unmodified
• Angaben zum Gen: human ... SMAD7(4092)

Beschreibung

Allgemeine Beschreibung

SMAD7 (mothers against decapentaplegic homolog 7) is a Tbx1 (T-box 1) interacting gene. It is an inhibitor of the TGFβ (transforming growth factor β) /BMP (bone morphogenetic proteins) pathway. It is located on chromosome 18q21.1.

Immunogen

SMAD family member 7 recombinant protein epitope signature tag (PrEST)

Anwendung

Anti-SMAD7 has been used in immunohistochemistry.

Biochem./physiol. Wirkung

SMAD7 (mothers against decapentaplegic homolog 7) is a modulator of TGFβ(transforming growth factor β) signaling in immune cells that are associated to ulcerative colitis and inflammatory bowel syndrome. It plays a major role in the etiology of CRC (colorectal cancer). It even functions as a mediator of the negative feedback loop for both the TGFβ and BMP (bone morphogenetic proteins) signaling pathways. It is essential for the remodelling of pharyngeal artery and the enlargement of great vessel. In mouse, homozygous removal of Smad7 causes primarily fourth-related arch artery defects. Silencing of Smad7 in RCD (refractory coeliac disease) biopsy samples can decrease the expression of interleukin-6 and tumour necrosis factor-α. Polymorphism of this gene is associated with colorectal cancer.

Leistungsmerkmale und Vorteile

Prestige Antibodies^® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies^® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.

Every Prestige Antibody is tested in the following ways:

• IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
• Protein array of 364 human recombinant protein fragments.

Verlinkung

Corresponding Antigen APREST86713

Physikalische Form

Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide.

Rechtliche Hinweise

Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany

Haftungsausschluss

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Sicherheitshinweise

• Lagerklassenschlüssel: 10 - Combustible liquids
• WGK: WGK 1