HPA019467

Anti-TAGLN antibody produced in rabbit

affinity isolated antibody, buffered aqueous glycerol solution

• Synonym(e): TAGLN Antibody - Anti-TAGLN antibody produced in rabbit, Tagln Antibody, Anti-22 kDa actin-binding protein, Anti-SM22-alpha, Anti-Smooth muscle protein 22-alpha, Anti-Transgelin, Anti-WS3-10
• UNSPSC-Code: 12352203
• Human Protein Atlas-Nummer: HPA019467
• NACRES: NA.41

Eigenschaften

• Biologische Quelle: rabbit
• Konjugat: unconjugated
• Antikörperform: affinity isolated antibody
• Antikörper-Produkttyp: primary antibodies
• Klon: polyclonal
• Form: buffered aqueous glycerol solution
• Speziesreaktivität: human
• Erweiterte Validierung: orthogonal RNAseq; Learn more about Antibody Enhanced Validation
• Methode(n): immunoblotting: 0.04-0.4 μg/mL; immunofluorescence: 0.25-2 μg/mL; immunohistochemistry: 1:200-1:500
• Immunogene Sequenz: EKKYDEELEERLVEWIIVQCGPDVGRPDRGRLGFQVWLKNGVILSKLVNSLYPDGSKPVKVPENPPSMVFKQMEQV
• UniProt-Hinterlegungsnummer: Q01995
• Versandbedingung: wet ice
• Lagertemp.: −20°C
• Posttranslationale Modifikation Target: unmodified
• Angaben zum Gen: human ... TAGLN(6876)

Beschreibung

Allgemeine Beschreibung

The gene TAGLN (transgelin) is mapped to human chromosome 11q23.2. It belongs to the calponin family. The protein is strongly expressed in the smooth muscle tissues.

Immunogen

Transgelin recombinant protein epitope signature tag (PrEST)

Anwendung

Anti-TAGLN antibody produced in rabbit, a Prestige Antibody, is developed and validated by the Human Protein Atlas (HPA) project . Each antibody is tested by immunohistochemistry against hundreds of normal and disease tissues. These images can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. The antibodies are also tested using immunofluorescence and western blotting. To view these protocols and other useful information about Prestige Antibodies and the HPA, visit sigma.com/prestige.

Biochem./physiol. Wirkung

TAGLN (transgelin) is an actin stress fiber binding protein. It is mainly involved in cell growth, differentiation, invasion, muscle fiber contractility and matrix remodeling. TAGLN is up-regulated in osteosarcoma cell lines, colorectal adenocarcinoma, prostate , hepatocellular , gastric, pancreatic and colon cancer. However, it is down-regulated in urinary bladder, renal cell carcinoma and colorectal cancer.

Leistungsmerkmale und Vorteile

Prestige Antibodies^® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies^® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.

Every Prestige Antibody is tested in the following ways:

• IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
• Protein array of 364 human recombinant protein fragments.

Verlinkung

Corresponding Antigen APREST74706

Physikalische Form

Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide

Rechtliche Hinweise

Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany

Haftungsausschluss

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Sicherheitshinweise

• Lagerklassenschlüssel: 10 - Combustible liquids
• WGK: WGK 1
• Flammpunkt (°F): Not applicable
• Flammpunkt (°C): Not applicable