HPA018129

Anti-ZFAND5 antibody produced in rabbit

Prestige Antibodies^® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution

• Synonym(e): Anti-AN1-type zinc finger protein 5, Anti-Zinc finger A20 domain-containing protein 2, Anti-Zinc finger protein 216
• UNSPSC-Code: 12352203
• Human Protein Atlas-Nummer: HPA018129
• NACRES: NA.41

Eigenschaften

• Biologische Quelle: rabbit
• Konjugat: unconjugated
• Antikörperform: affinity isolated antibody
• Antikörper-Produkttyp: primary antibodies
• Klon: polyclonal
• Produktlinie: Prestige Antibodies^® Powered by Atlas Antibodies
• Form: buffered aqueous glycerol solution
• Speziesreaktivität: human
• Erweiterte Validierung: recombinant expression; Learn more about Antibody Enhanced Validation
• Methode(n): immunoblotting: 0.04-0.4 μg/mL; immunofluorescence: 0.25-2 μg/mL; immunohistochemistry: 1:200-1:500
• Immunogene Sequenz: TASGSNSPTSDSASVQRADTSLNNCEGAAGSTSEKSRNVPVAALPVTQQMTEMSISREDKITTPKTEVSEPVVTQPSPSVSQPSTSQSEEKAPELPKPKK
• UniProt-Hinterlegungsnummer: O76080
• Versandbedingung: wet ice
• Lagertemp.: −20°C
• Posttranslationale Modifikation Target: unmodified
• Angaben zum Gen: human ... ZFAND5(7763)

Beschreibung

Allgemeine Beschreibung

The gene has been mapped to human chromosome 9q13-q21. AN1-type zinc finger protein (ZFAND5) contains an A20-like zinc finger domain and AN1-like domain at the N- and C-terminus respectively. The two domains interact with each other. The protein is predominantly expressed in brain and skeletal muscles. Protein localizes largely in the cytoplasm and to a lesser extent in the nucleus of COS-7 cells.

Immunogen

AN1-type zinc finger protein 5 recombinant protein epitope signature tag (PrEST)

Anwendung

All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the industry.

The Human Protein Atlas project can be subdivided into three efforts: Human Tissue Atlas, Cancer Atlas, and Human Cell Atlas. The antibodies that have been generated in support of the Tissue and Cancer Atlas projects have been tested by immunohistochemistry against hundreds of normal and disease tissues and through the recent efforts of the Human Cell Atlas project, many have been characterized by immunofluorescence to map the human proteome not only at the tissue level but now at the subcellular level. These images and the collection of this vast data set can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. We also provide Prestige Antibodies^® protocols and other useful information.

Biochem./physiol. Wirkung

AN1-type zinc finger protein (ZFAND5) regulates degradation of muscle proteins by binding to the polyubiquitin chains and associating with the 26S proteasome. ZFAND5-deficient mice exhibit resistance to muscle atrophy accompanied by abnormal accumulation of polyubiquitinylated proteins in the skeletal muscle. The protein interacts with inhibitor of nuclear factor-κ-B kinase subunit γ (IKKγ), receptor-interacting serine/threonine-protein kinase-1 (RIP) and TNF receptor-associated factor-6 (TRAF6). Overexpressed ZFAND5 inhibit RIP- and TRAF6-mediated NF-κ-B activation. Additionally, it could inhibit tumor necrosis factor (TNF), interleukin-1 (IL-1), and toll-like receptor 4 (TLR4) triggered NF-κ-B activation. Overexpression of the protein sensitizes cells to TNF-induced apoptosis. ZFAND5 is also an inhibitory factor for osteoclast differentiation.

Leistungsmerkmale und Vorteile

Prestige Antibodies^® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies^® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.

Every Prestige Antibody is tested in the following ways:

• IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
• Protein array of 364 human recombinant protein fragments.

Verlinkung

Corresponding Antigen APREST73691

Physikalische Form

Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide

Rechtliche Hinweise

Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany

Haftungsausschluss

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Sicherheitshinweise

• Lagerklassenschlüssel: 10 - Combustible liquids
• WGK: WGK 1
• Flammpunkt (°F): Not applicable
• Flammpunkt (°C): Not applicable