HPA011101

Anti-SPINT2 antibody produced in rabbit

Prestige Antibodies^® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution

• Synonym(e): Anti-HAI-2 antibody produced in rabbit, Anti-Hepatocyte growth factor activator inhibitor type 2 antibody produced in rabbit, Anti-Kunitz-type protease inhibitor 2 precursor antibody produced in rabbit, Anti-Placental bikunin antibody produced in rabbit
• UNSPSC-Code: 12352203
• Human Protein Atlas-Nummer: HPA011101

Eigenschaften

• Biologische Quelle: rabbit
• Qualitätsniveau: 100
• Konjugat: unconjugated
• Antikörperform: affinity isolated antibody
• Antikörper-Produkttyp: primary antibodies
• Klon: polyclonal
• Produktlinie: Prestige Antibodies^® Powered by Atlas Antibodies
• Form: buffered aqueous glycerol solution
• Speziesreaktivität: human
• Methode(n): immunohistochemistry: 1:200- 1:500
• Immunogene Sequenz: CLVSKVVGRCRASMPRWWYNVTDGSCQLFVYGGCDGNSNNYLTKEECLKKCATVTENATGDLATSRNAADSSVPSAPRRQDSEDHSSDMFNYEEYCTANAVTGPCRASFPRWYFDVERNSCNNFIYGGCRGNKNSYRSE
• UniProt-Hinterlegungsnummer: O43291
• Versandbedingung: wet ice
• Lagertemp.: −20°C
• Posttranslationale Modifikation Target: unmodified
• Angaben zum Gen: human ... SPINT2(10653)

Beschreibung

Allgemeine Beschreibung

SPINT2 (serine peptidase inhibitor, Kunitz type, 2) is a transmembrane Kunitz-type serine protease inhibitor, which contains two Kunitz-type domains. This protein is also called hepatocyte growth factor activator (HGFA) inhibitor 2 (HAI-2). It has a wide range of tissue expression, with predominant expression in kidney, prostate and placenta. It is also expressed in the non-epithelial cells in brain and lymph nodes.

Immunogen

Kunitz-type protease inhibitor 2 precursor recombinant protein epitope signature tag (PrEST)

Anwendung

All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the industry.

The Human Protein Atlas project can be subdivided into three efforts: Human Tissue Atlas, Cancer Atlas, and Human Cell Atlas. The antibodies that have been generated in support of the Tissue and Cancer Atlas projects have been tested by immunohistochemistry against hundreds of normal and disease tissues and through the recent efforts of the Human Cell Atlas project, many have been characterized by immunofluorescence to map the human proteome not only at the tissue level but now at the subcellular level. These images and the collection of this vast data set can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. We also provide Prestige Antibodies^® protocols and other useful information.

Biochem./physiol. Wirkung

SPINT2 (serine peptidase inhibitor, Kunitz type, 2) is responsible for suppressing the enzyme hepatocyte growth factor activator (HGFA), which converts hepatocyte growth factor (HGF) in its active form. It might play a role in homeostasis of ions in intestine, and mutations in this gene are linked to syndromic congenital sodium diarrhea. It is up-regulated in cholangiopathies, and impacts fibrosis and differentiation of liver. In mice, it plays an essential role in the survival of embryo, placental development and neural tube closure. It inhibits a variety of serine proteases such as, pancreatic trypsin, plasmin, kallikrein. It is a putative tumor suppressor gene, and is down-regulated in certain solid cancers. It is under-expressed in Myelodysplastic syndromes (MDS), and alters the adhesion of mesenchymal stromal cells (MSCs) to pluripotent stem cells or leukemia cells. This leads to the maintenance of abnormal survival, proliferation and self-renewal of pluripotent stem cells, contributing to the pathophysiology of MDS.

Leistungsmerkmale und Vorteile

Prestige Antibodies^® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies^® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.

Every Prestige Antibody is tested in the following ways:

• IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
• Protein array of 364 human recombinant protein fragments.

Verlinkung

Corresponding Antigen APREST72190

Physikalische Form

Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide

Rechtliche Hinweise

Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany

Haftungsausschluss

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Sicherheitshinweise

• Lagerklassenschlüssel: 10 - Combustible liquids
• WGK: WGK 1
• Persönliche Schutzausrüstung: Eyeshields, Gloves, multi-purpose combination respirator cartridge (US)