HPA010022

Anti-ALDH1A2 antibody produced in rabbit

Prestige Antibodies^® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution

• Synonym(e): ALDH1A2 Antibody - Anti-ALDH1A2 antibody produced in rabbit, Aldh1A2 Antibody, Anti-Aldehyde dehydrogenase family 1 member A2, Anti-RALDH 2, Anti-RALDH(II), Anti-RalDH2, Anti-Retinal dehydrogenase 2, Anti-Retinaldehyde-specific dehydrogenase type 2
• UNSPSC-Code: 12352203
• Human Protein Atlas-Nummer: HPA010022
• NACRES: NA.41

Eigenschaften

• Biologische Quelle: rabbit
• Konjugat: unconjugated
• Antikörperform: affinity isolated antibody
• Antikörper-Produkttyp: primary antibodies
• Klon: polyclonal
• Produktlinie: Prestige Antibodies^® Powered by Atlas Antibodies
• Form: buffered aqueous glycerol solution
• Speziesreaktivität: human
• Erweiterte Validierung: orthogonal RNAseq; Learn more about Antibody Enhanced Validation
• Methode(n): immunoblotting: 0.04-0.4 μg/mL; immunohistochemistry: 1:200-1:500
• Immunogene Sequenz: VVGSPFDPTTEQGPQIDKKQYNKILELIQSGVAEGAKLECGGKGLGRKGFFIEPTVFSNVTDDMRIAKEEIFGPVQEILRFKTMDEVIERANNSDFGLVAAVFTNDINKALTVSSAMQAGTV
• UniProt-Hinterlegungsnummer: O94788
• Versandbedingung: wet ice
• Lagertemp.: −20°C
• Posttranslationale Modifikation Target: unmodified
• Angaben zum Gen: human ... ALDH1A2(8854)

Beschreibung

Allgemeine Beschreibung

Aldehyde dehydrogenase 1 family, member A2 (ALDH1a2) gene is mapped to human chromosome 15q21.3. It belongs to the aldehyde dehydrogenase (ALDH) family. The product of ALDH1a2 gene is the enzyme retinaldehyde dehydrogenase type 2. The protein is found in few adult tissues, mainly in the urogenital tract.

Immunogen

Retinal dehydrogenase 2 recombinant protein epitope signature tag (PrEST)

Anwendung

Anti-ALDH1A2 antibody produced in rabbit has been used in:

• immunohistochemistry
• immunofluorescence
• western blotting

Anti-ALDH1A2 antibody produced in rabbit, a Prestige Antibody, is developed and validated by the Human Protein Atlas (HPA) project . Each antibody is tested by immunohistochemistry against hundreds of normal and disease tissues. These images can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. The antibodies are also tested using protein array and western blotting. To view these protocols and other useful information about Prestige Antibodies and the HPA, visit sigma.com/prestige. Anti-ALDH1A2 antibody is also suitable for use in indirect immunofluorescence.

Biochem./physiol. Wirkung

Aldehyde dehydrogenase 1 family, member A2 (ALDH1a2), also known as retinaldehyde dehydrogenase type II (RALDH2), catalyzes the synthesis of all trans-retinoic acid from vitamin A. ALDH1a2 acts as a tumor suppressor. It plays a vital role in early embryonic and cardiac development. Variation in the ALDH1a2 gene expression may increase the risk of developing congenital heart disease (CHD). Reduced levels of ALDH1a2 has been observed in human prostate cancer patients.

Leistungsmerkmale und Vorteile

Prestige Antibodies^® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies^® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.

Every Prestige Antibody is tested in the following ways:

• IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
• Protein array of 364 human recombinant protein fragments.

Verlinkung

Corresponding Antigen APREST71490

Physikalische Form

Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide

Rechtliche Hinweise

Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany

Haftungsausschluss

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Sicherheitshinweise

• Lagerklassenschlüssel: 10 - Combustible liquids
• WGK: WGK 1
• Persönliche Schutzausrüstung: Eyeshields, Gloves, multi-purpose combination respirator cartridge (US)