HPA008791

Anti-MYBL1 antibody produced in rabbit

Prestige Antibodies^® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution

• Synonym(e): Anti-A-Myb antibody produced in rabbit, Anti-Myb-related protein A antibody produced in rabbit
• UNSPSC-Code: 12352203
• Human Protein Atlas-Nummer: HPA008791
• NACRES: NA.41

Eigenschaften

• Biologische Quelle: rabbit
• Konjugat: unconjugated
• Antikörperform: affinity isolated antibody
• Antikörper-Produkttyp: primary antibodies
• Klon: polyclonal
• Produktlinie: Prestige Antibodies^® Powered by Atlas Antibodies
• Form: buffered aqueous glycerol solution
• Speziesreaktivität: human
• Methode(n): immunohistochemistry: 1:50- 1:200
• Immunogene Sequenz: EANAVLSSLQTIPEFAETLELIESDPVAWSDVTSFDISDAAASPIKSTPVKLMRIQHNEGAMECQFNVSLVLEGKKNTCNGGNSEAVPLTSPNIAKFSTPPAILRKKRKMRVGHSPGSELRDGSLNDGGN
• UniProt-Hinterlegungsnummer: P10243
• Versandbedingung: wet ice
• Lagertemp.: −20°C
• Posttranslationale Modifikation Target: unmodified
• Angaben zum Gen: human ... MYBL1(4603)

Beschreibung

Allgemeine Beschreibung

MYBL1 (v-myb avian myeloblastosis viral oncogene homolog-like 1) gene is localized to human chromosome 8q13.1, and codes for a transcription factor. It is a member of the oncoprotein family called Myb. Its N-terminal contains DNA-binding repeats, and its C-terminal contains two conserved regions. Its c-Myb transactivation domain contains a putative leucine zipper.

Immunogen

Myb-related protein A recombinant protein epitope signature tag (PrEST)

Anwendung

Anti-MYBL1 antibody produced in rabbit, a Prestige Antibody, is developed and validated by the Human Protein Atlas (HPA) project . Each antibody is tested by immunohistochemistry against hundreds of normal and disease tissues. These images can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. The antibodies are also tested using immunofluorescence and western blotting. To view these protocols and other useful information about Prestige Antibodies and the HPA, visit sigma.com/prestige.

These images and the collection of this vast data set can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. We also provide Prestige Antibodies^® protocols and other useful information.

Biochem./physiol. Wirkung

MYBL1 (v-myb avian myeloblastosis viral oncogene homolog-like 1) is partially duplicated in 28% of diffuse astrocytoma grade II tumors. This gene is characterized by recurrent oncogenic truncating rearrangements in pediatric low-grade gliomas. This gene is thought to be involved in the control of differentiation and proliferation of normal B-cells and Burkitt′s lymphoma cells. It also acts as an interacting partner of CBP (CREB-binding protein) protein, where its charged sequence binds with the CREB (cAMP response element-binding protein)-binding domain of CBP.

Leistungsmerkmale und Vorteile

Prestige Antibodies^® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies^® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.

Every Prestige Antibody is tested in the following ways:

• IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
• Protein array of 364 human recombinant protein fragments.

Verlinkung

Corresponding Antigen APREST71002

Physikalische Form

Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide

Rechtliche Hinweise

Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany

Haftungsausschluss

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Sicherheitshinweise

• Lagerklassenschlüssel: 10 - Combustible liquids
• WGK: WGK 1
• Persönliche Schutzausrüstung: Eyeshields, Gloves, multi-purpose combination respirator cartridge (US)