HPA001672

Anti-SLC9A3R2 antibody produced in rabbit

Prestige Antibodies^® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution

• Synonym(e): Anti-NHE3 kinase A regulatory protein E3KARP antibody produced in rabbit, Anti-NHERF-2 antibody produced in rabbit, Anti-Na⁺/H⁺ exchange regulatory cofactor NHE-RF2 antibody produced in rabbit, Anti-SIP-1 antibody produced in rabbit, Anti-SRY-interacting protein 1 antibody produced in rabbit, Anti-Solute carrier family 9 isoform A3 regulatory factor 2 antibody produced in rabbit, Anti-TKA-1 antibody produced in rabbit, Anti-Tyrosine kinase activator protein 1 antibody produced in rabbit
• UNSPSC-Code: 12352203
• Human Protein Atlas-Nummer: HPA001672
• NACRES: NA.41

Eigenschaften

• Biologische Quelle: rabbit
• Konjugat: unconjugated
• Antikörperform: affinity isolated antibody
• Antikörper-Produkttyp: primary antibodies
• Klon: polyclonal
• Produktlinie: Prestige Antibodies^® Powered by Atlas Antibodies
• Form: buffered aqueous glycerol solution
• Speziesreaktivität: human
• Erweiterte Validierung: orthogonal RNAseq; Learn more about Antibody Enhanced Validation
• Methode(n): immunohistochemistry: 1:200- 1:500
• Immunogene Sequenz: RLVEVNGVNVEGETHHQVVQRIKAVEGQTRLLVVDQETDEELRRRQLTCTEEMAQRGLPPAHDPWEPKPDWAHTGSHSSEAGKKDVSGPLRELRPRLCHLRKGPQGYGFNLH
• UniProt-Hinterlegungsnummer: Q15599
• Versandbedingung: wet ice
• Lagertemp.: −20°C
• Posttranslationale Modifikation Target: unmodified
• Angaben zum Gen: human ... SLC9A3R2(9351)

Beschreibung

Immunogen

Na⁺/H⁺ exchange regulatory cofactor NHE-RF2 recombinant protein epitope signature tag (PrEST)

Anwendung

All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the industry.

The Human Protein Atlas project can be subdivided into three efforts: Human Tissue Atlas, Cancer Atlas, and Human Cell Atlas. The antibodies that have been generated in support of the Tissue and Cancer Atlas projects have been tested by immunohistochemistry against hundreds of normal and disease tissues and through the recent efforts of the Human Cell Atlas project, many have been characterized by immunofluorescence to map the human proteome not only at the tissue level but now at the subcellular level. These images and the collection of this vast data set can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. We also provide Prestige Antibodies^® protocols and other useful information.

Biochem./physiol. Wirkung

SLC9A3R2 (solute carrier family 9, subfamily A, NHE3, cation proton antiporter 3, member 3 regulator 2) is a major adaptor protein involved in the anchoring of ion channels and receptors to the actin cytoskeleton via ERM (ezrin/radixin/moesin) protein interaction. It works as a Na⁺/H⁺ exchanger in the brush border membrane of the proximal tubule and small intestine. It plays a major role in the trans-epithelial Na⁺ absorption, which is regulated by cAMP (cyclic adenosine monophosphate). The protein consists of two PSD-95/Dlg/ZO-1 (PDZ) domains, which bind the PDZ docking motif (X-(S/T)-X-(V/L)) of proteins to allow the assembly of transmembrane and cytoplasmic proteins into active signal transduction complexes. In SGK1 (serum and glucocorticoid induced protein kinase 1) activation mechanism, it helps to activate and phosphorylate SGK1 by 3-phosphoinositide-dependent protein kinase 1 (PDK1) through its PDZ domain and PIF (PDK1 interacting fragment) motif.

Leistungsmerkmale und Vorteile

Prestige Antibodies^® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies^® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.

Every Prestige Antibody is tested in the following ways:

• IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
• Protein array of 364 human recombinant protein fragments.

Verlinkung

Corresponding Antigen APREST85045

Physikalische Form

Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide

Rechtliche Hinweise

Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany

Haftungsausschluss

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Sicherheitshinweise

• Lagerklassenschlüssel: 10 - Combustible liquids
• WGK: WGK 1
• Flammpunkt (°F): Not applicable
• Flammpunkt (°C): Not applicable
• Persönliche Schutzausrüstung: Eyeshields, Gloves, multi-purpose combination respirator cartridge (US)