Direkt zum Inhalt
Merck

HPA001204

Sigma-Aldrich

Anti-STX17 antibody produced in rabbit

enhanced validation

Prestige Antibodies® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution

Synonym(e):

Anti-KAT01814 antibody produced in rabbit, Anti-Syntaxin-17 antibody produced in rabbit

Anmeldenzur Ansicht organisationsspezifischer und vertraglich vereinbarter Preise


About This Item

UNSPSC-Code:
12352203
Human Protein Atlas-Nummer:
NACRES:
NA.41

Biologische Quelle

rabbit

Qualitätsniveau

Konjugat

unconjugated

Antikörperform

affinity isolated antibody

Antikörper-Produkttyp

primary antibodies

Klon

polyclonal

Produktlinie

Prestige Antibodies® Powered by Atlas Antibodies

Form

buffered aqueous glycerol solution

Speziesreaktivität

human

Erweiterte Validierung

RNAi knockdown
Learn more about Antibody Enhanced Validation

Methode(n)

immunoblotting: 0.04-0.4 μg/mL
immunohistochemistry: 1:200-1:500

Immunogene Sequenz

RLEPAIQKFIKIVIPTDLERLRKHQINIEKYQRCRIWDKLHEEHINAGRTVQQLRSNIREIEKLCLKVRKDDLVLLKRMIDPVKEEASAATAEFLQLHLESVEELKKQFNDEETLLQPPLTRSMTVGGAFHTTEAEASSQSLTQ

UniProt-Hinterlegungsnummer

Versandbedingung

wet ice

Lagertemp.

−20°C

Posttranslationale Modifikation Target

unmodified

Angaben zum Gen

human ... STX17(55014)

Allgemeine Beschreibung

Syntaxin 17 (Stx17) is an autophagosomal SNARE (soluble N-ethylmaleimide-sensitive factor attachment protein receptor) protein. STX17 is a member of the syntaxin family and is located on human chromosome 9q31. It is stored in the cytosol.

Immunogen

Syntaxin-17 recombinant protein epitope signature tag (PrEST)

Anwendung

Anti-STX17 antibody has been used:
  • in SNARE (soluble N-ethylmaleimide-sensitive factor attachment protein receptor) protein reconstitution
  • in immunoelectron microscopy
  • to investigate its relevance to the hepatitis C virus (HCV) life cycle and, thereby, to reveal the role of autophagosome-lysosome fusion for the turnover of viral particles

Anti-STX17 antibody produced in rabbit is suitable for co-immunoprecipitation.
Anti-STX17 antibody produced in rabbit, a Prestige Antibody, is developed and validated by the Human Protein Atlas (HPA) project . Each antibody is tested by immunohistochemistry against hundreds of normal and disease tissues. These images can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. The antibodies are also tested using immunofluorescence and western blotting. To view these protocols and other useful information about Prestige Antibodies and the HPA, visit sigma.com/prestige.

Biochem./physiol. Wirkung

Syntaxin 17 (STX17) is an autophagosomal SNARE (soluble N-ethylmaleimide–sensitive factor attachment protein receptors) that in involved in fusion with the endosome/lysosome. It is mostly localized to the ER and to some extent in the ER-Golgi intermediate compartment (ERGIC). It may function as a receptor at the ER membrane that is involved in the trafficking between the ER and post-ER compartments. It cycles between ER and ERGIC via pathways involving COPII and COPI (coatomer protein I) vesicle. The protein is required for the maintenance of ERGIC and Golgi architecture.
Syntaxin 17 (Stx17) encodes membrane proteins, that participates in synaptic vesicle fusion.

Leistungsmerkmale und Vorteile

Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.

Every Prestige Antibody is tested in the following ways:
  • IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
  • Protein array of 364 human recombinant protein fragments.

Verlinkung

Corresponding Antigen APREST79900

Physikalische Form

Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide

Rechtliche Hinweise

Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany

Haftungsausschluss

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Sie haben nicht das passende Produkt gefunden?  

Probieren Sie unser Produkt-Auswahlhilfe. aus.

Lagerklassenschlüssel

10 - Combustible liquids

WGK

WGK 1

Persönliche Schutzausrüstung

Eyeshields, Gloves, multi-purpose combination respirator cartridge (US)


Hier finden Sie alle aktuellen Versionen:

Analysenzertifikate (COA)

Lot/Batch Number

Die passende Version wird nicht angezeigt?

Wenn Sie eine bestimmte Version benötigen, können Sie anhand der Lot- oder Chargennummer nach einem spezifischen Zertifikat suchen.

Besitzen Sie dieses Produkt bereits?

In der Dokumentenbibliothek finden Sie die Dokumentation zu den Produkten, die Sie kürzlich erworben haben.

Die Dokumentenbibliothek aufrufen

Jennifer Jung et al.
Bio-protocol, 7(17), 27982478-27982478 (2017-10-03)
Autophagy is a recycling pathway, in which intracellular cargoes including protein aggregates and bacteria are engulfed by autophagosomes and subsequently degraded after fusion with lysosomes. Dysregulation of this process is involved in several human diseases such as cancer or neurodegeneration.
Huimei Ren et al.
Journal of virology, 90(13), 5989-6000 (2016-04-22)
Syntaxin 17 is an autophagosomal SNARE (soluble N-ethylmaleimide-sensitive factor attachment protein receptor) protein required for the fusion of autophagosomes with lysosomes to form autolysosomes and thereby to deliver the enclosed contents for degradation. Hepatitis C virus (HCV) induces autophagy. In
LAMP-2 is required for incorporating syntaxin-17 into autophagosomes and for their fusion with lysosomes
Hubert V, et al.
Biology Open, bio-018648 (2016)
The autophagosomal SNARE protein syntaxin 17 is an essential factor for the hepatitis C virus life cycle
Ren H, et al.
Journal of Virology, 520(7548), JVI-00551 (2016)
The autophagosomal SNARE protein syntaxin 17 is an essential factor for the hepatitis C virus life cycle
Ren H, et al.
Journal of virology, JVI-00551 (2016)

Unser Team von Wissenschaftlern verfügt über Erfahrung in allen Forschungsbereichen einschließlich Life Science, Materialwissenschaften, chemischer Synthese, Chromatographie, Analytik und vielen mehr..

Setzen Sie sich mit dem technischen Dienst in Verbindung.